KEGG   Anabaena sp. 90: ANA_C12542Help
Entry
ANA_C12542        CDS       T02341                                 

Definition
(GenBank) two-component sensor and regulatory system
Organism
anb  Anabaena sp. 90
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DICT CHASE6_C HD_5 tRNA-synt_2c
Motif
Other DBs
NCBI-ProteinID: AFW95263
UniProt: K7WI94
Position
chANA01:complement(2867960..2869360)
Genome map
AA seq 466 aa AA seqDB search
MLQGSILQQLEASHRHSARPIHFGVYYKNTLVSLCHALEDHILTKDNDPLVITAFQQGKW
YLEEAQRYADIAQHSRAIVIMAAADAGFAEHPTGQLSNIDLVGLAADDPVAQEWHLMILA
PDYTAMVICQELSEADYGKDGLPTCDLERKFYGLWTFEPELVEETAELAIAHIKDYHPEL
ALKLSQYKQAIHPAICPGEEVATVVSRVVDYLKTGQGNLPVLTASHQKFLDHNLVSNEIQ
AFLRMAQLIDLADSRNPVAASEVASLAETMGQLLDLPAWQIKRLRLAALLHRLDPLQKAE
SLISPSHITTAYQEQSPSCPLACPLVPAAQALRIMPRLRAIAQIITHQSEWWNGTGEPAG
LAGDDIPLESRILSLVAEFQLQVNQYKYSSKGGAEIFSQALDQCRKQQSTRFDPKLVDTL
TLLVMGLQQGLDLPIMTPKVSSGLWLLDSRWDTDSKSSEQISVYSK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaggttcaattcttcaacagttagaagcatctcaccgccatagtgctagacct
attcattttggcgtgtactataaaaataccttagtgtctctctgccatgccttggaagat
catattttaacgaaagataatgatcctttggtgattacggctttccagcagggtaaatgg
tatctggaagaggctcaaagatacgcagatatcgcgcaacacagccgggcaattgtgatt
atggcggcggctgatgctggttttgccgaacatcctactggtcaattatctaacattgat
ttagtgggattagctgctgatgatcctgtggcgcaggagtggcatttgatgattttagct
cctgactacacagctatggtaatttgtcaagagttatctgaagctgactatgggaaggat
ggtttgccaacttgcgatttagagcgtaaattctacggtttatggacatttgaaccggaa
ttagtggaagaaaccgcagagttagcgatcgctcatatcaaagactatcatcctgaacta
gcactcaaactaagtcaatataaacaagcaattcacccagctatctgtccaggagaagaa
gtagctaccgttgtctctcgtgttgttgattacctcaaaaccggacaaggtaacttacct
gttctcacagcatctcaccaaaaatttctagatcataacttggtatctaacgaaattcag
gcatttttgcggatggcacaattgattgatctagcagatagccgtaatcctgtagccgcg
tcagaagtagcatctctcgctgaaacaatggggcaattattggatttaccagcatggcaa
attaaaagattacgcctagctgctttattgcatcgcttagacccactgcaaaaagccgaa
agcctgattagtcccagtcatataacaacagcttatcaagaacaatctcctagttgtcct
ctggcttgtcccctcgtaccagcagcgcaagcactacgaatcatgccaagactacgggct
atagctcaaattatcacccaccaaagcgaatggtggaatggtacaggcgaacccgccggt
ttagctggtgatgatattcctttagaatcaagaattttatcattggttgcagaatttcag
ctacaagttaaccagtataaatactctagcaaagggggagcagagatattttctcaagcc
ttagatcagtgccgaaaacaacaatctactcgctttgatcctaaacttgtagatacatta
actttattagtgatgggtttacaacaggggcttgatttaccgataatgacacccaaggtc
agcagcggtttatggttacttgactcccgttgggataccgacagcaaaagtagtgagcag
atttcagtgtacagcaaatga

DBGET integrated database retrieval system