KEGG   Anabaena sp. 90: ANA_C13177Help
Entry
ANA_C13177        CDS       T02341                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
anb  Anabaena sp. 90
Pathway
anb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
anb01100  Metabolic pathways
anb01110  Biosynthesis of secondary metabolites
anb01130  Biosynthesis of antibiotics
anb01230  Biosynthesis of amino acids
Module
anb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:anb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ANA_C13177 (trpC)
Enzymes [BR:anb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ANA_C13177 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth
Motif
Other DBs
NCBI-ProteinID: AFW95858
UniProt: K7WJT3
Position
chANA01:3592580..3593434
Genome map
AA seq 284 aa AA seqDB search
MIYPTTSYNHQMQAIIQEIVWQKKLEVAQIQKDMSWASLQRQLTAAPTVRDFFTALQLSI
YKPSLIAEVKKASLYHSVIRPDFDPVTIAQAYKKGGASCVSVVTDQKFFHGGFDHLRAIR
YRVGIPLLCKDFIIDPCQIYLARSAGADAILLIAAILTDKQLQNFLRVIHYLGMNAVIQV
HNLNDLDRVLALEDVRIVSIDNQSLSDFNININTTQELLAARRSQLQNLGILVISESGIE
TPDDLSFVAEAGVQTVIMGESLLKENDLEVAVRNLLQSKFPIHY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgatctacccaaccacaagttataatcatcaaatgcaagcaattattcaagaaattgtg
tggcagaaaaaactagaagttgcacaaatacaaaaagatatgtcttgggcttccttgcaa
cgtcagttaactgctgctcctactgtccgggacttttttacggctttgcagttgagtatt
tataaacctagtttaattgcagaagtgaaaaaagcatcactttatcatagtgtaattaga
ccagattttgatccagttactattgctcaggcttataaaaaaggaggagcatcttgtgta
tctgttgtcactgatcaaaagttttttcatggtgggtttgatcatcttcgtgctatcaga
tatcgcgtaggaatacctctactttgcaaagattttatcattgatccttgccaaatttat
ttagcccgttccgctggtgcagatgcaatattattaattgctgctattctgacagataag
caattacaaaacttcttacgagtgattcactacttagggatgaatgctgttatccaagtt
cataacttaaatgatttggatagggttctcgcattagaagatgtcaggatagtttccatt
gataaccagagtttaagtgattttaatatcaatattaacactactcaggaattattggca
gctaggcgatcgcaacttcaaaacctaggaattttagtcatcagtgaatcaggaatagaa
acccctgatgatttatcctttgttgctgaagctggtgtccaaacagtgattatgggagaa
tctttgcttaaagaaaatgatttagaagtagctgtcagaaatttactccaatccaaattt
cctattcattattaa

DBGET integrated database retrieval system