KEGG   Actinomyces naeslundii: AN27039_2245Help
Entry
AN27039_2245      CDS       T05566                                 

Definition
(GenBank) riboflavin kinase
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
ane  Actinomyces naeslundii
Pathway
ane00740  Riboflavin metabolism
ane01100  Metabolic pathways
ane01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ane00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    AN27039_2245
Enzymes [BR:ane01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     AN27039_2245
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     AN27039_2245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_syn CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: BAV85315
UniProt: A0A2Z5QSE8
Position
2129940..2130191
Genome map
AA seq 83 aa AA seqDB search
MEVWYGAEQVPASLSAPGGPGAVVTMGIFDGVHRGHQAVLGRVVELSHELAHGDRRPLAV
AVTFDPTPVASTSPRPTCPSSPP
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
gtggaggtctggtacggcgccgagcaggtgccagcgagcctgagcgctccgggagggccg
ggcgccgtggtcacgatgggcatcttcgacggcgtccaccgcgggcatcaggcggtcctg
gggcgcgtcgtcgagctctcccatgagctcgcccacggcgaccggcggcccctggccgtc
gcggtcaccttcgaccccacccccgtagcgtccaccagcccgaggccgacctgcccctca
tcgcctccctga

DBGET integrated database retrieval system