KEGG   Aspergillus niger: ANI_1_1104074Help
Entry
ANI_1_1104074     CDS       T01030                                 

Gene name
An08g07840
Definition
(RefSeq) NADPH--cytochrome P450 reductase
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     ANI_1_1104074 (An08g07840)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 Flavodoxin_5
Motif
Other DBs
NCBI-GeneID: 4983103
NCBI-ProteinID: XP_001392901
UniProt: A2QS05
AA seq 695 aa AA seqDB search
MAQLDTLDLVVLAVLLVGSVAYFTKGTYWAVAKDPYASTGPAMNGAAKAGKTRNIIEKME
ETGKNCVIFYGSQTGTAEDYASRLAKEGSQRFGLKTMVADLEEYDYENLDQFPEDKVAFF
VLATYGEGEPTDNAVEFYQFFTGDDVAFESGASADEKPLSKLKYVAFGLGNNTYEHYNAM
VRQVDAAFQKLGAQRIGSAGEGDDGAGTMEEDFLAWKEPMWAALSESMDLQEREAVYEPV
FCVTENESLSPEDETVYLGEPTQSHLQGTPKGPYSAHNPFIAPIAESRELFTVKDRNCLH
MEISIAGSNLSYQTGDHIAVWPTNAGAEVDRFLQVFGLEGKRDSVINIKGIDVTAKVPIP
TPTTYDAAVRYYMEVCAPVSRQFVATLAAFAPDEESKAEIVRLGSDKDYFHEKVTNQCFN
IAQALQSITSKPFSAVPFSLLIEGITKLQPRYYSISSSSLVQKDKISITAVVESVRLPGA
SHMVKGVTTNYLLALKQKQNGDPSPDPHGLTYSITGPRNKYDGIHVPVHVRHSNFKLPSD
PSRPIIMVGPGTGVAPFRGFIQERAALAAKGEKVGPTVLFFGCRKSDEDFLYKDEWKTYQ
DQLGDNLKIITAFSREGPQKVYVQHRLREHSELVSDLLKQKATFYVCGDAANMAREVNLV
LGQIIAAQRGLPAEKGEEMVKHMRSSGSYQEDVWS
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaactcgacaccctcgatctggtggtcctggcggtgcttttggtgggtagcgtg
gcctacttcaccaagggcacctactgggcagttgccaaagacccgtatgcctctaccggc
cccgcgatgaacggcgccgctaaggctggcaagactcggaacatcattgagaaaatggaa
gaaacgggcaagaattgtgttattttctacggatcgcaaactggaaccgcggaggactac
gcctccagattggccaaggaaggatctcagcgcttcggcctcaagaccatggtggctgac
ctcgaggaatacgactatgagaacctggaccaattcccggaggacaaggttgcgtttttc
gtgctcgccacctacggagagggtgagcctacggataatgctgttgagttctaccagttc
ttcaccggtgacgacgttgcttttgagagcggcgcttccgcggacgagaagcctctgtcc
aagctgaagtatgttgctttcggtctgggtaacaacacttatgagcactacaacgccatg
gttcgtcaagtcgatgctgctttccagaagctcggcgcgcagcgtattggttctgctggc
gagggtgatgacggtgccggtacaatggaagaagacttcttggcctggaaggagcccatg
tgggcagcactgtcggagtcgatggatctgcaagagcgtgaagcggtctacgaacctgtt
ttctgcgtcaccgaaaacgagtccctgagccctgaggacgagacggtctatcttggagag
cccacccagagccaccttcagggtactcccaaaggcccgtactctgcgcacaaccccttt
atcgcccctattgccgaatctcgtgagcttttcaccgtcaaggatcgcaactgtctgcac
atggaaattagcatcgctggaagtaacttgtcctaccagactggtgaccacatcgctgtt
tggcccacaaacgctggtgccgaagtggatcggttccttcaggtcttcggtctcgagggc
aagcgtgattcggtcatcaacatcaagggtatcgatgttacggccaaggtcccaatcccg
accccgaccacgtacgatgccgctgttcggtactatatggaagtctgcgcccctgtgtcc
cgtcagtttgtagccactctggccgcgttcgctccggatgaggaaagcaaggcagagatt
gtgcgtctgggtagcgacaaggactatttccacgagaaggtcaccaaccaatgcttcaac
atcgcccaggctcttcagagcatcacgtccaagcctttctctgctgttccgttctctctg
cttattgaaggcattacgaagctgcagcctcgctactactcgatctcttcgtcctccctt
gtccagaaggacaagatcagcatcacggccgttgtggaatctgttcgtctgcccggtgcc
tctcacatggtgaagggtgtgactacgaattatctcctcgcgctcaagcagaagcagaac
ggcgatccctctcccgaccctcacggcttgacttactccatcaccggtccccggaacaag
tacgacggtatccacgttcccgtgcatgttcgccactcgaacttcaagctgccctctgat
ccctctcggcccattatcatggttggtcctggtactggtgttgctcctttccgtggtttc
attcaggaacgtgctgctttggcggccaagggcgagaaggttggacccactgttctcttc
ttcggttgccgcaagagtgacgaggatttcttgtacaaggatgaatggaagacctatcag
gaccagcttggagacaacttgaagatcatcactgcgttctcgcgtgagggtcctcagaag
gtctacgttcagcacagactccgcgagcactccgaacttgtcagcgaccttctgaagcag
aaagctaccttctacgtctgtggtgacgctgcaaacatggctcgcgaggttaaccttgtg
cttggccagatcattgctgcgcagcgtggtctgcccgccgagaagggcgaagaaatggtc
aagcacatgcgtagcagtggcagctaccaggaagatgtgtggtcataa

DBGET integrated database retrieval system