KEGG   Aspergillus niger: ANI_1_1218084Help
Entry
ANI_1_1218084     CDS       T01030                                 

Gene name
An09g02560
Definition
(RefSeq) polyamine oxidase
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
ang  Aspergillus niger
Pathway
ang00330  Arginine and proline metabolism
ang00410  beta-Alanine metabolism
ang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ANI_1_1218084 (An09g02560)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ANI_1_1218084 (An09g02560)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     ANI_1_1218084 (An09g02560)
    1.5.3.16  spermine oxidase
     ANI_1_1218084 (An09g02560)
    1.5.3.-  
     ANI_1_1218084 (An09g02560)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_3 Thi4 Pyr_redox_2 FAD_binding_3 Pyr_redox GIDA FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 4983788
NCBI-ProteinID: XP_001393570
AA seq 536 aa AA seqDB search
MHTIPITVSLYAFLATTFLFSCSAYVAQAPLSDDKCTETTVAILGGGMAGIAAAQALSNA
SIDDFIILEYRDTLGGRVWHTDFGKDKQGKPYVIELGANWLQGLGSEAIENPVWALAKKY
RLKNTYSNYSSIRTYNETGYTDYRYLLDEYAQAYHIAARDAGRILTQNLQDQTARTGLAL
AGWRPRKNDMAAQAVEWWSWDWEDAHTPETSSLVFGIAGENLTFNQFGKANHLVLDPRGY
STIIQNEALGFLPNPSDGRLRLNTRVTRIEYSPRGVTIHTTNDNNKNSNTCIRAAYAICT
FSLGVLQNKAVTFDPPLPSWKQTAIEKFNMGTYTKIFMQFPETFWPTDTQFFLYASPTTR
GYYPVFQSLSTENFLPESNILFATVVDEQAYRVERQSLTQTKDQILNVLREMFPDKHIPE
PTAFTYPRWTNEPWVYGSYSNWPAGTTLEMHQNLRANTGRLWFAGEATSAAYFGFLHGAW
YEGRDAGENVAALLQGRCVEDKEEACGERVFYEQLNGTTPLDAYSRLNGWPAVSYY
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgcatacgatacccatcaccgtttctttatacgccttcctagcgacgacctttctgttc
tcctgctccgcttatgttgcacaggcaccgctgagcgatgacaagtgcaccgaaacaacg
gtggccatcttgggtggagggatggccggtattgcagctgcacaagccttgtccaacgca
tctatcgacgactttatcatcctcgaatatcgcgataccctaggtggccgtgtctggcat
acggatttcggcaaggataaacaaggcaagccatacgtgattgagctaggagccaactgg
ctccaaggactcggctccgaagctatcgagaatccagtctgggcactagccaaaaaatac
cgtctcaaaaacacctactctaactacagctccatccgaacatacaacgaaaccggctac
accgactaccgctatttgctcgacgaatacgcgcaagcctaccacatcgccgcccgcgat
gctggccgcattctgacccagaacctacaagaccaaaccgcacgcaccgggctcgccctc
gccggctggagaccacgcaagaatgacatggcggcacaagccgtggaatggtggagctgg
gactgggaagacgcacatacgcccgaaaccagctccttggtcttcggcatcgccggtgag
aacctaaccttcaaccaattcggcaaagccaaccacctcgtcctcgacccgcgcggctac
agcaccatcattcaaaacgaagccctcggtttcctacccaacccctctgatggccgccta
cgcctaaacacccgcgtcactcgcattgaatactccccaaggggcgtaacaatccacacc
accaacgacaacaacaaaaacagcaacacctgcatccgagcggcctacgcaatctgcacc
ttctccctgggcgtcctccaaaacaaagccgtaaccttcgacccacctttgccctcctgg
aaacaaaccgccatcgagaaattcaacatgggcacctacaccaagatattcatgcaattc
cctgagaccttttggcccacagacacgcaatttttcctatacgcttccccaacaacaaga
ggctactaccctgtcttccaatccctctccacagagaacttcctccctgaatcaaacatc
ctcttcgccaccgtggtcgacgaacaagcctaccgcgttgaacgccaatccttgactcaa
acgaaggaccagatcctcaatgttctaagagagatgttccctgataaacacatccctgag
cctacggcgtttacttacccccgctggacgaatgaaccctgggtctacggcagctactcc
aactggccggcgggaacgacccttgagatgcatcagaatctgcgggcgaatacgggccgg
ctgtggttcgcaggcgaagcgaccagtgcggcgtatttcgggttcttgcatggtgcgtgg
tatgaggggcgcgatgcgggtgagaatgttgccgcgctgttgcaggggaggtgtgttgag
gataaggaggaagcgtgtggagagagggtcttttatgagcaattaaatgggactacgccg
ctggatgcgtatagtcggttgaacgggtggccggcggtaagttactactag

DBGET integrated database retrieval system