KEGG   Aspergillus niger: ANI_1_1272024Help
Entry
ANI_1_1272024     CDS       T01030                                 

Gene name
An02g08850
Definition
(RefSeq) ubiquitin conjugating enzyme (UbcB)
Organism
ang  Aspergillus niger
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con Prok-E2_B RWD UEV
Motif
Other DBs
NCBI-GeneID: 4979377
NCBI-ProteinID: XP_001400020
UniProt: A2QDZ9
AA seq 153 aa AA seqDB search
MGSQKRIAKELAELVESPPEGIVVKLADESNLYAWNVYMDGPEGSPYQNGKFQLNLSLPT
EYPFKPPTVSFKTKIYHPNVTNDDKGSMCLGMLRADEWKPSSKILAVLQFARQLLAEPMP
DDAVEGRIAEQFKNDHNRYEEVAKEWTRKYATV
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgggaagccaaaaacggatagctaaggagctcgccgagcttgtcgaatctcccccggag
ggcatcgtggtaaagctggccgacgaatccaacctttacgcatggaacgtatacatggac
ggacctgagggatctccttaccagaacggcaaattccaacttaacctgtcccttcccacc
gaataccccttcaaaccccctaccgtctccttcaaaacgaagatctaccatcccaatgtg
accaacgatgacaagggaagcatgtgcctgggcatgcttagggccgacgaatggaagcct
agttccaagattttggcagtgctgcagttcgcgcgtcagttgctcgcagaaccgatgccc
gatgatgccgtcgagggacggatcgcagagcagtttaaaaatgaccacaatcggtacgag
gaagttgcgaaggagtggacacgcaagtatgccactgtttag

DBGET integrated database retrieval system