KEGG   Aspergillus niger: ANI_1_1348134Help
Entry
ANI_1_1348134     CDS       T01030                                 

Gene name
An15g03260
Definition
(RefSeq) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ang  Aspergillus niger
Pathway
ang00260  Glycine, serine and threonine metabolism
ang01100  Metabolic pathways
ang01110  Biosynthesis of secondary metabolites
ang01130  Biosynthesis of antibiotics
ang01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANI_1_1348134 (An15g03260)
Enzymes [BR:ang01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     ANI_1_1348134 (An15g03260)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 4987927
NCBI-ProteinID: XP_001396864
AA seq 367 aa AA seqDB search
MASVSTASNGSRPSTWQGAGAAEFDLRSDTMTKPTPAMLEAICQTTLLDDVFGEDPVTND
LEAYVAERTQHESALLVMSGTMGNQVAIRTHLKEPPYSVLCDHRSHIICYEAGGVSSLTG
ATVMPVTPKNGVHLTLEDIKKHAVLSDNIHYCPTKLISLENTLDGMVMPLSEARRITEWA
HQNNIKVHLDGARLWEAVVSGAGSLPDYTTLFDSVSLCFSKGLGAPIGSIIVGSNEFIKK
ARWFRKSIGGGVRQAGVISAAARVAVEETFGPDPNGQQGKLLGSHQRAKKVADMWTSRGG
KLSHPVQTNMVWLDVEGSGLGPDDLAEIGREKGLKLGGSRIVVHYQVSEESLSRLEQVFE
AAMNKKA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggctagcgtatcaacagcttccaatgggagcagacccagcacgtggcagggcgctggg
gcagctgagtttgacctgagaagtgatacaatgaccaagccaactccggcaatgctcgag
gctatctgccagaccacacttcttgacgatgtcttcggtgaagacccagtgacaaatgat
cttgaagcttatgtggcagagcgtactcaacatgaaagcgctctcttggtcatgtctggc
acaatgggcaaccaggttgccatccgcacgcacctgaaggaaccgccttattctgtcttg
tgcgatcatcggtctcatatcatctgttacgaggctggtggagtaagctccctcacgggc
gctacggtcatgcccgtcaccccgaagaatggtgttcaccttactttggaggatataaag
aaacatgcggtactcagcgataacatccactactgtcctacgaagctcatcagtcttgag
aacacgttggatgggatggttatgccactttctgaggctcggcgtatcactgaatgggcc
catcaaaacaacatcaaggtccatctggatggtgcgagactttgggaagcagtggtgtcc
ggtgccggtagtttgcctgactacactactttgttcgatagcgtaagcctatgtttctcg
aagggcttaggtgcccccattggaagtattattgttggctcgaacgagttcatcaagaaa
gctcgatggtttcgcaaatccatcggtggtggtgtacgtcaagctggagtcatctctgcg
gcggcccgcgtcgcggttgaggagacatttggaccagaccccaatggacagcaagggaag
cttctagggtctcatcagagagcaaagaaggttgccgatatgtggactagccgtggaggc
aagctatctcacccggtacagaccaacatggtgtggttggacgtcgaggggtcgggcttg
gggcctgatgacctggctgagatcggacgtgaaaaggggttgaagcttgggggtagtcgc
attgtcgtccactaccaggtatccgaagagtccctctctcgactcgagcaggtgtttgag
gcagctatgaacaagaaagcttga

DBGET integrated database retrieval system