KEGG   Aspergillus niger: ANI_1_1364084Help
Entry
ANI_1_1364084     CDS       T01030                                 

Gene name
An09g03890
Definition
(RefSeq) 2-hydroxyacid dehydrogenase UNK4.10
  KO
K00015  glyoxylate reductase [EC:1.1.1.26]
Organism
ang  Aspergillus niger
Pathway
ang00630  Glyoxylate and dicarboxylate metabolism
ang01100  Metabolic pathways
ang01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ANI_1_1364084 (An09g03890)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.26  glyoxylate reductase
     ANI_1_1364084 (An09g03890)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 4983924
NCBI-ProteinID: XP_001393705
UniProt: A2QU03
AA seq 331 aa AA seqDB search
MPAALLIGAITHSMPEWNDLSSILTLKEFPSGTREDFIRNCRDGQYDDVVAIYRSNTSTK
FTGPFDAELLSVLPSSLKYIAHNGAGYDNIDVAACTKKGIAVSSTPVAVNNATADVAIFL
MIGALRQAYIPVTSLREGKFLGQTGLGHDPQNKVLGILGMGGIGREVARRARAFGMTIQY
HNRSRLSPELEDGATYVSFDELLANSDVLSLNLALNASTRHIIGKTEFQKMKDGVIIVNT
ARGALIDEKALVEALESGKVWSAGLDVYENEPAIEPGLVNNPRVMLLPHIGTMTYETQRE
MELLVLNNLRSGVETGKMITLVPEQKDVFGK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgcattgctgatcggtgccatcacccattccatgcccgaatggaatgatctc
tcctccatcctgaccttgaaggaattcccctccggaactcgcgaagactttattcgcaat
tgccgcgacggccagtacgatgatgtagtcgccatctatcgctctaacacttctaccaag
ttcaccggcccattcgacgcagaattactctccgtcctgccctcctcactcaagtacatc
gcccacaatggcgcaggttacgataacatcgacgtcgcggcctgcacgaagaaaggcatc
gccgtctccagcactcccgtcgcagttaacaacgccaccgccgacgtggccatcttccta
atgattggcgctctgcgacaggcatacattcccgtcacatctctccgcgaaggaaaattc
ctcggccaaacaggcctcggacacgatccccagaacaaggtgcttggaatcctcggcatg
ggaggaatcggccgtgaggtcgctcgtcgtgcgcgcgccttcggaatgaccatccagtac
cacaaccggtcgcgtctctccccggaactcgaggacggagcgacctacgtctcatttgat
gagctgctcgccaattctgatgttttgagtctgaatctggcgctgaatgcgtctactcgt
catattattggcaagacggagttccagaagatgaaggatggtgtgattattgttaatacg
gcgcggggtgccttgattgatgagaaggccttggttgaggcgctggagtcgggcaaggta
tggtctgctgggctggatgtctatgagaatgaacccgccattgagccgggattggtaaac
aaccctcgggtcatgctgctgccgcacatcgggacaatgacttatgagacgcaacgggag
atggagctactggtgttgaacaacttgcgctctggcgtggagacggggaagatgattact
ttggtgccggagcagaaagatgtgtttggaaaatag

DBGET integrated database retrieval system