KEGG   Aspergillus niger: ANI_1_1478134Help
Entry
ANI_1_1478134     CDS       T01030                                 

Gene name
An15g04440
Definition
(RefSeq) hypothetical protein
Organism
ang  Aspergillus niger
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C Gp_dh_N AdoHcyase_NAD 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 4988045
NCBI-ProteinID: XP_001396979
AA seq 352 aa AA seqDB search
MASQEFLLILMPCAFPDKWIASMRSAVPHIRIEKREIDRNATELPTDISPGTWRDVTALF
TWKLLPPKELVPSLQYVQLLSAGCNHVMGTSLFAETDVAFCTANGVHPPQITEWVFMTFL
AFQHHLPGYLEHQKLGQWIDPTSDEDTEDAVGLRVGIMGYGSIGRQCARVAKAFGMNVHA
FTLHPRTTPESRKTDSFSEPGLGDEDGQFPSKWFSGKDQLNEFLGSDLDLLVITVPLTRE
TRGMIGREQFRHLSKKKAYVSNIARGAVIKTDDLMDALDAGHIRGAALDVTDPEPLPADH
KLWGYKNVIITPHCSGNSTHYNDRAIKILQCNFERRARGQQLLNQVDKGLGY
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccaggaattcctgttaattctcatgccgtgcgcttttccagacaaatggatt
gccagcatgaggagcgctgtcccccacatccgcatcgagaaacgcgaaattgacaggaat
gctacggagctgcccacagatatctcccccgggacatggagggatgttacagcactcttt
acttggaagcttcttccgcccaaggagctggtcccaagtctacaatatgtccagctcttg
agtgccgggtgcaatcatgttatggggacctcgctattcgctgagactgacgtcgcgttt
tgtacagcgaatggggttcatccacctcaaatcacagaatgggttttcatgacattcctc
gccttccagcaccatctacccggatatctggagcaccagaagctcggccaatggatcgat
cccacatcggacgaagacaccgaggatgcagttggtctcagagttggaataatgggctat
ggaagtatcggccggcaatgcgcccgggtcgccaaagccttcggcatgaatgtccatgcc
ttcacactccacccacgaaccacgcccgagtcccgaaaaacagattcattcagcgagcca
ggtctgggggacgaagacggtcaatttccgtccaagtggttctcgggcaaagatcaactc
aacgagttcctaggttcggatctcgatttgctggtgatcactgtcccgctgactagagag
acgcgaggtatgattgggagggagcagtttagacatctcagcaagaagaaggcatatgtg
agcaacattgcacgcggggcagtgatcaaaacagatgaccttatggatgccctggatgcg
ggtcacatccgaggagcggccctggatgttacggatccggagccattgccggctgaccat
aagctgtggggttataaaaatgttattattacgccgcattgcagtgggaactcaacccac
tataacgaccgtgctatcaagatactgcagtgtaattttgaaagacgggctcgagggcag
cagcttctcaaccaggttgataagggcttgggatactga

DBGET integrated database retrieval system