KEGG   Aspergillus niger: ANI_1_1580074Help
Entry
ANI_1_1580074     CDS       T01030                                 

Gene name
An08g00300
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ang  Aspergillus niger
Pathway
ang00230  Purine metabolism
ang01100  Metabolic pathways
Module
ang_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ANI_1_1580074 (An08g00300)
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ANI_1_1580074 (An08g00300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 AAA_33 AAA_22 RNA_helicase AAA_24 RsgA_GTPase MMR_HSR1 ABC_tran T2SSE AAA_28 NACHT DUF2075 AAA AAA_29 NTPase_1 AAA_30 AAA_14 AAA_5 Adeno_IVa2 ATPase_2 Pox_A32 cobW Viral_helicase1
Motif
Other DBs
NCBI-GeneID: 4982332
NCBI-ProteinID: XP_001392148
UniProt: A2QPV2
AA seq 200 aa AA seqDB search
MATSAVHKFRPVVVSGPSGTGKSTLLKRLFSEIPDRFGFSISHTTRAPRPGEQDGREYYF
TTKEDFLDLVSKNGFIEHAQFGGNHYGTSVQAVKNIAEQGRICILDIEMEGVKQVKRTDL
NARFLFLAPPSVEELEKRLRGRGTETEESLTKRLTQAKNELEYAKQPGAHDKTVVNDDLE
KAYTELRDWIVDGGNFGASQ
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctaccagtgctgtgcacaagttccgtccggtggtggtgtctggcccctcaggtaca
ggaaaatcgactctgttgaagcgactgttctccgagattcctgatcgcttcgggttttcc
atctcgcataccactcgtgcgcctagaccgggtgagcaggatggccgcgaatactacttt
acgacaaaggaggacttcttggatcttgtgagcaagaacggcttcatcgagcatgcacaa
tttggcggaaaccactacggtaccagcgtgcaagccgttaagaacattgcggagcagggc
cggatctgtatccttgatattgagatggagggagtgaagcaggtgaagcgtaccgacctt
aacgctcgtttcctgttcctggcgcccccctcggtggaggagctggagaagagattgcgc
gggagaggcacggagactgaggagagcttgaccaagcgtctcacacaggccaagaacgag
ctcgaatacgctaagcagccgggggctcacgacaaaactgttgtaaatgacgacttggag
aaggcgtatacggagttgagggattggatcgttgacggtggcaactttggtgcgtcgcaa
tag

DBGET integrated database retrieval system