KEGG   Aspergillus niger: ANI_1_1780104Help
Entry
ANI_1_1780104     CDS       T01030                                 

Gene name
An12g04590
Definition
(RefSeq) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
ang  Aspergillus niger
Pathway
ang00670  One carbon pool by folate
ang00790  Folate biosynthesis
ang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ANI_1_1780104 (An12g04590)
   00670 One carbon pool by folate
    ANI_1_1780104 (An12g04590)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ANI_1_1780104 (An12g04590)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 4985807
NCBI-ProteinID: XP_001395528
AA seq 258 aa AA seqDB search
MPPSRPITLIVATTPIPTEGSSIRLGIGHSGTLPWPRIKTDMSFFARVTSRPPTPGTTNA
IIMGRKTYDSVPAHLRPLAKRISTIITRDVDSLTERVGREVEVRREKIAASAAASASAGG
NGGNAEQPATDAIVCGGLNDALQQLETRYGEEGKLGKVFVIGGAEIYGAVLAAGKDVWGG
PVRIVMTNVEKKGYAEGNKGEVFECDTFFPVDEELFGEKEGWRKVSAEEVTEWVGEVVTG
EWIEEGDVRVQMVGYERQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcccccatcacgccccataaccctcatcgtcgcaacgacccccatccccaccgaaggc
agctcaatccgcctcggcatcggccactccgggactctcccctggccacgaatcaaaacc
gacatgtcgttcttcgcgcgcgtcacctcccggccacctaccccgggcaccaccaacgcc
atcataatgggtcggaagacgtacgactctgtgcctgcgcatctccgcccgctggccaag
cgcatcagcactattataacacgggatgtggattctctaactgagagggtggggagggag
gttgaggttaggcgggagaagattgctgcgtctgctgctgcatctgcatctgctggtggt
aatggggggaatgctgagcaacccgcaacggatgcgattgtgtgcgggggactaaatgat
gcgctgcagcagctggagacgaggtatggagaggaagggaagctggggaaggtgtttgtg
attgggggggcggagatatatggggctgttttggctgcgggaaaggatgtttggggaggg
ccagtgaggattgtgatgacgaatgtggagaagaaggggtatgcggaggggaataagggg
gaggtgtttgagtgtgatacgtttttccccgtggatgaggagttgtttggggagaaggag
gggtggaggaaggttagtgcggaggaggttacggagtgggttggggaggtggttactggg
gagtggattgaggagggggatgttagggtgcagatggtgggttatgaacgtcaatag

DBGET integrated database retrieval system