KEGG   Aspergillus niger: ANI_1_2064014Help
Entry
ANI_1_2064014     CDS       T01030                                 

Gene name
An01g00130
Definition
(RefSeq) glutamyl-tRNA amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ang  Aspergillus niger
Pathway
ang00970  Aminoacyl-tRNA biosynthesis
ang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ANI_1_2064014 (An01g00130)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ang03029]
    ANI_1_2064014 (An01g00130)
Enzymes [BR:ang01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ANI_1_2064014 (An01g00130)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ANI_1_2064014 (An01g00130)
Mitochondrial biogenesis [BR:ang03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ANI_1_2064014 (An01g00130)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase REV
Motif
Other DBs
NCBI-GeneID: 4977151
NCBI-ProteinID: XP_001388465
UniProt: A2Q7C3
AA seq 504 aa AA seqDB search
MSLLREAEKCLANQGSHAALNALITTLHQSGQWLERVRDADARRTRGTPKSEIDGRLVAV
KDNMCTRDLPTTCASNALDKFVSPFNATVVQQLEDAGAVVAGKANLDEFGMGSHSIHSNF
GPVRSSRRGQDAEYLSAGGSSGGSAVAVATAQCYAALGTDTGGSVRLPAAYTGTVGFKPS
YGLVSRWGVVAYANSLDTVGVLGRDVASVRHVFGVVNQHDSRDPTNLSPSSRSRIDSHLK
MSALASRTSSPLRIGVPLEYNISELSPSARHAWSRSLAYLQRQGHSIQTVSLPTTKLALS
AYYVLAPAEASSNLAKYDGVRYGSRPEAPDGNASSERYLYAKTRGDGFGSEVKRRILLGA
FSLSADAMDNYFIQAQRVRRLVQHDFNAAFRACQPLISSQLGSKSGSADTGVDVLICPTA
PSSPPRISSLIGPDATTSPLEAYTNDVFTVPASLAGLPAISVPVTTENADGAEDGDLAGI
QVIGQYGDDELVLKVAELLEGRHL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcctgcgggaagccgagaagtgcttggctaatcagggctctcatgcggctcta
aatgcgctaattaccaccctacatcagtcaggacaatggttggaacgtgtgagagatgcg
gatgcgcggcgcacccgggggacgcctaaatctgagatagatggccggttggttgccgtc
aaggacaatatgtgcacacgcgaccttccaacaacatgcgcttcaaacgctctggacaaa
ttcgtcagtccgtttaacgcgacagtcgttcaacaattggaggatgcaggcgctgtcgtg
gccgggaaagctaatctcgacgaatttggaatgggctcccactctattcattcaaacttt
ggccctgtcagaagctcgcgccgtggccaggatgcagaatacctctcagccggtggtagt
tcgggtggaagtgcggttgctgttgcgacagcccaatgttacgcagcgttgggaactgat
acaggcggctccgtgcgattacccgcagcatatacgggaacagtcggcttcaagccttct
tatgggctggtctctcgctggggagtggttgcgtacgctaattcactggatacagtcggt
gtactgggaagggacgtggccagcgttcgccatgtcttcggcgtcgtgaaccagcatgat
tcacgcgatcccactaacctttctccctccagtcggtcacggatagactcacatcttaaa
atgtctgctttggcatctcggacaagttctcctcttaggataggagtccctctcgagtac
aacatatcagagttgtctccatctgcgcgacatgcgtggtctcgctctctggcctatttg
caacgacagggccatagcatccaaacggtgtcccttccaacgaccaaactcgccttatcg
gcatattacgtactcgcgcctgctgaggcatcctcaaacctggccaagtatgatggcgtc
aggtacggaagccgccccgaagcaccagacggaaatgcatcatcagaaaggtatctatat
gcgaaaacacgaggtgatgggttcggctccgaagtcaaaagacgaattttgctcggggca
tttagcctaagcgctgacgctatggataactacttcattcaagcacagcgggttcgccgc
cttgtccaacatgacttcaacgccgcgtttagggcatgccagccattgatttcctcgcaa
cttggatcaaagtcgggttctgcagacaccggtgtagatgttctcatttgcccgacagcg
ccatcatcaccaccacgcatttcaagccttataggacctgatgcgacaacttcgcctttg
gaggcatatacgaatgatgtatttactgtgcctgctagtttggcaggtcttccggctata
tctgtgccggtcactacagaaaatgctgatggcgccgaggatggagatctggctggaatc
caagtaattggccaatacggtgatgatgagcttgtgttaaaggttgccgagctgctcgag
ggcaggcacctatga

DBGET integrated database retrieval system