KEGG   Aspergillus niger: ANI_1_2068074Help
Entry
ANI_1_2068074     CDS       T01030                                 

Gene name
An08g06710
Definition
(RefSeq) D-isomer specific 2-hydroxyacid dehydrogenase family protein
  KO
K00018  glycerate dehydrogenase [EC:1.1.1.29]
Organism
ang  Aspergillus niger
Pathway
ang00260  Glycine, serine and threonine metabolism
ang00630  Glyoxylate and dicarboxylate metabolism
ang00680  Methane metabolism
ang01100  Metabolic pathways
ang01110  Biosynthesis of secondary metabolites
ang01130  Biosynthesis of antibiotics
ang01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ANI_1_2068074 (An08g06710)
  09102 Energy metabolism
   00680 Methane metabolism
    ANI_1_2068074 (An08g06710)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANI_1_2068074 (An08g06710)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.29  glycerate dehydrogenase
     ANI_1_2068074 (An08g06710)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh F420_oxidored
Motif
Other DBs
NCBI-GeneID: 4982988
NCBI-ProteinID: XP_001392786
AA seq 336 aa AA seqDB search
MAPPSSPTDHHIVALQGDFIRIPKFELPAPYTHTTKVYGLTSLSELHERIHDASILVLSA
LRIDAEALSPEVTPYLKLIVIVAAGSDCVDLEACRKRGITVSNCPAANTEAVSEHAIGLY
FSVRRRVLRAHTLTRAGEWTRKKTLVFDCVNHDGTQPLTCQEEVAGIIGNGAVARGLGMK
VIIAGRKALGDGSTPTHAGDGEERVSFAEVIKRSTVIFIAVPLAPSTRNLLSATEFEAMS
PHAVLVNVSRGGVVDEVALVRALQENRITGAATDVFEKEPAGPENCALLGEGTEDLNLVL
TPHIAWATQKTLINYERKLKETVEKWMVGEFMNVVT
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggcacctccctcgtctcctactgaccaccacatcgtggctctgcagggcgattttatc
agaatccccaagttcgaactacccgctccttatactcacaccacaaaagtctacgggctg
acatcgctctccgaacttcatgaacggatacacgatgcctctatcttagttctatcggcg
ctgcgaatcgatgcagaggcactgtctcccgaggtgacaccatacctgaaactgatcgtg
atagtcgccgcaggcagcgactgcgtggatctcgaagcatgcagaaagaggggcattact
gtgagcaactgtcccgcagcaaacaccgaggctgtttccgagcatgcaattggactatac
ttctctgtacgccgtagagtcctgcgcgcgcacacattgacccgcgcgggcgaatggacc
cggaaaaagaccctcgtcttcgattgtgtgaatcacgacggaacgcaacccctgacctgc
caggaggaggtggccggaattatcggaaatggcgctgtcgcccgtgggctgggaatgaag
gtcattatcgcaggccgcaaagcactcggtgatggtagcacaccgactcatgctggtgac
ggtgaagagagagtttctttcgccgaagtgattaagcggagcacggtgattttcattgca
gttccccttgctccttcgacgcggaatctgctatcagctacagaattcgaagccatgtcg
cctcatgcggtcttggtcaatgtctcgaggggaggagtggtggatgaagtggcacttgtc
cgagcattgcaggagaaccgcatcaccggtgctgcaaccgatgtgttcgaaaaagaacct
gccggaccggaaaactgtgctctgctgggtgaagggaccgaggatctgaacctggttctt
acacctcatattgcatgggccacgcagaagacgttgatcaactatgagcggaaattgaag
gagaccgtcgagaagtggatggtgggggaattcatgaatgtagtgacatga

DBGET integrated database retrieval system