KEGG   Aspergillus niger: ANI_1_2182064Help
Entry
ANI_1_2182064     CDS       T01030                                 

Gene name
An07g09990
Definition
(RefSeq) heat shock protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ang  Aspergillus niger
Pathway
ang03040  Spliceosome
ang04141  Protein processing in endoplasmic reticulum
ang04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    ANI_1_2182064 (An07g09990)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    ANI_1_2182064 (An07g09990)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    ANI_1_2182064 (An07g09990)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ang01009]
    ANI_1_2182064 (An07g09990)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ang03041]
    ANI_1_2182064 (An07g09990)
   03009 Ribosome biogenesis [BR:ang03009]
    ANI_1_2182064 (An07g09990)
   03110 Chaperones and folding catalysts [BR:ang03110]
    ANI_1_2182064 (An07g09990)
   04131 Membrane trafficking [BR:ang04131]
    ANI_1_2182064 (An07g09990)
   03051 Proteasome [BR:ang03051]
    ANI_1_2182064 (An07g09990)
   03029 Mitochondrial biogenesis [BR:ang03029]
    ANI_1_2182064 (An07g09990)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ang04147]
    ANI_1_2182064 (An07g09990)
Protein phosphatases and associated proteins [BR:ang01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     ANI_1_2182064 (An07g09990)
Spliceosome [BR:ang03041]
 Complex B
  Other components
   Prp19 complex
    ANI_1_2182064 (An07g09990)
 Complex C
   Prp19-CDC5 complex
    ANI_1_2182064 (An07g09990)
Ribosome biogenesis [BR:ang03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    ANI_1_2182064 (An07g09990)
Chaperones and folding catalysts [BR:ang03110]
 Heat shock proteins
  HSP70 / DNAK
   ANI_1_2182064 (An07g09990)
Membrane trafficking [BR:ang04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    ANI_1_2182064 (An07g09990)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    ANI_1_2182064 (An07g09990)
Proteasome [BR:ang03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    ANI_1_2182064 (An07g09990)
Mitochondrial biogenesis [BR:ang03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    ANI_1_2182064 (An07g09990)
Exosome [BR:ang04147]
 Exosomal proteins
  Proteins found in most exosomes
   ANI_1_2182064 (An07g09990)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C FtsA FAD-SLDH
Motif
Other DBs
NCBI-GeneID: 4982268
NCBI-ProteinID: XP_001392074
AA seq 596 aa AA seqDB search
MAPAVGIDLGTTYSCVGVFRDDRIEIIANDQGNRTTPSFVAFTDTERLIGDAAKNQVAMN
PHNTVFDAKRLIGRRFADAEVQSDMKHWPFKVVEKGGKPIVEVEFKGETKQFTPEEVSSM
ILTKMRETAEAYLGGTVNNAVITVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIA
YGLDKKPRDFDNRLVNHFVNEFKRKHKKDLTSNARALRRLRTACERAKRTLSSAAQTSIE
IDSLFEGIDFYTSITRARFEELCQDLFRSTMEPVERVLRDAKIDKSSVHEIVLVGGSTRI
PKIQRLVSDFFNKDANKSINPDEAVAYGAAVQAAILSGDTSSKSTNEILLLDVAPLSLGI
ETAGGVMTALIKRNTTIPTKKSETFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTG
IPPAPRGVPQIEVTFDLDANGIMNVSAIEKGTGKTNKITITNDKGRLSKEEIERMLAEAE
KFKAEDEAEASRIQAKNGLESYAYSLKNTINEGKLTISDEDKQKVTAKVDEVISWLDSNQ
TAEKDEYEAQQKELEGVANPIISAAYGGAAGAAPGGAAPGATRTADEVEERPEELD
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggcccccgctgttggtatcgatttgggaaccacctactcctgtgtgggtgtcttccgt
gatgaccgcattgaaatcatcgccaacgaccagggtaaccgcactaccccctctttcgtg
gctttcaccgacaccgagcgtctcatcggtgatgccgccaagaaccaggtcgccatgaac
cctcacaacaccgtcttcgatgctaagcgtctgatcggtcgtcgttttgccgacgctgag
gtccagtccgacatgaagcactggcccttcaaggttgtcgagaagggtggcaagcccatc
gtcgaggttgagttcaagggcgagaccaagcagttcacccccgaggaggtctcctccatg
atcctcaccaagatgcgtgagaccgctgaggcctacctcggtggcaccgtcaacaacgct
gtcatcactgtccccgcctacttcaacgactctcagcgtcaggccaccaaggatgctggt
ctcattgccggcctgaacgttctccgtatcatcaacgagcccaccgctgctgccattgcc
tacggtctggacaagaagccgagggacttcgacaaccgcctcgtcaaccacttcgtcaac
gagttcaagcgcaagcacaagaaggacctcacctccaacgctcgtgctctccgtcgtctc
cgcaccgcttgcgagcgtgccaagcgtaccctctcttccgctgcccagacctccattgag
atcgactctctcttcgagggtatcgacttctacacctccatcacccgtgctcgtttcgag
gagctctgccaggacctcttccgttccaccatggagcccgtcgagcgtgtcctccgtgac
gccaagatcgacaagtcctccgtccacgagatcgtcctggtcggtggttccacccgtatc
cccaagatccagcgtctcgtcagtgacttcttcaacaaggacgccaacaagtccatcaac
cccgatgaggccgttgcctacggtgctgccgtccaggctgctatcctgtctggtgacact
tcctccaagtccaccaacgagatcctcctgctcgacgttgcccctctctccctcggtatc
gagaccgctggtggtgtcatgactgctctcatcaagcgcaacaccaccatccccaccaag
aagtccgagaccttctccacctactccgacaaccagcccggtgtcttgatccaggtctac
gagggtgagcgtgcccgtaccaaggacaacaacctgctcggcaagttcgagctcactggc
atcccccccgccccccgtggtgttccccagattgaggtcaccttcgaccttgatgccaac
ggaatcatgaacgtctctgccatcgagaagggtaccggcaagaccaacaagatcaccatc
accaacgacaagggccgtctctccaaggaggagatcgagcgcatgcttgctgaggccgaa
aagttcaaggctgaggacgaggctgaggcttcccgtatccaggccaagaacggtctcgag
tcctacgcttactccctcaagaacaccatcaacgagggcaagctcaccatcagcgatgag
gacaagcagaaggtcaccgccaaggttgacgaggtcatcagctggctcgacagcaaccag
accgccgagaaggacgagtacgaggctcagcagaaggagcttgagggtgttgccaacccc
atcatctccgctgcctacggtggtgccgctggtgccgcccccggcggtgctgcccccggt
gctacccgcactgctgacgaggtcgaggagcgccctgaggagctcgactaa

DBGET integrated database retrieval system