KEGG   Aspergillus niger: ANI_1_2238094Help
Entry
ANI_1_2238094     CDS       T01030                                 

Gene name
An11g07270
Definition
(RefSeq) 2-hydroxyacid dehydrogenase UNK4.10
Organism
ang  Aspergillus niger
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 CoA_transf_3 F420_oxidored
Motif
Other DBs
NCBI-GeneID: 4984947
NCBI-ProteinID: XP_001394701
UniProt: A2QX18
AA seq 336 aa AA seqDB search
MSSAKPRILFFNPVRHAVPFYEKLQEHAQTEVVTSKGREEFFKDVTGKYKDIFAIYRTSA
SGAVAGKFDAELINHLPESCKYIFHNGAGYDPIDTEACAKRGIIVTNAPDPVTDATADLA
VLLLLGALRNLNPAIRSLYAGTFKQGVGFGHDPQGKTLGILGMGRIGRAVKQRCEPFGIK
TVYNNRRPLSADLSAGAEYVSFEKLLTESDIISINVPLNANTKHLIGAAEIAKMKPGIVI
INTARGAIIDEAAMADALETGQIGAVGLDVYEREPEINEKLAKNERALLVPHIGTHTYET
LAKMEEWAMENARRAIMGEVLLSPVPEHSELVNGNA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggctaagccccgcattctcttcttcaaccccgtgaggcacgcagtgccgttc
tatgagaagctccaagaacatgcccaaacagaggttgtgacaagtaaaggcagggaggag
ttcttcaaagatgtcacaggcaaatataaagatatttttgccatctatcggacatccgct
agcggtgcagtagccggcaagttcgacgcagaactaatcaaccatcttcccgaaagttgc
aaatacatttttcacaatggagcaggctatgacccaatcgacacggaagcctgcgccaag
cgaggcatcatcgtcaccaacgccccagacccagtcacagatgcaaccgctgacctagca
gtcctcctcctcctgggtgctctccgaaacctcaaccctgcgattcgctccctctacgca
ggaaccttcaaacaaggcgtaggttttggccacgacccccaaggcaagacgctaggtatc
ctcggtatgggccgaatcggtcgcgctgtcaaacagcgctgcgagccttttggcatcaag
accgtctataataatcgacgtcctttatctgctgatttatccgcgggggccgagtatgtc
tcgtttgagaagctgctcactgagagcgatattattagtattaacgtgcccctgaatgcg
aatacaaagcacttgattggcgcagccgagatcgcgaaaatgaagcccggtattgttatt
atcaatactgctcgtggtgctattattgatgaggctgctatggccgatgccctggagact
gggcaaatcggcgctgttgggttggatgtgtatgaacgggagccggagattaacgagaag
cttgcgaagaatgaacgtgcgcttttggtgccgcatattgggacgcatacgtatgagacg
ctggcgaagatggaggagtgggcgatggagaatgcgagacgggcgattatgggtgaggtg
ttgttgtcgccagttccggagcattcggagttggtgaatgggaatgcttga

DBGET integrated database retrieval system