KEGG   Aspergillus niger: ANI_1_230104
Entry
ANI_1_230104      CDS       T01030                                 

Gene name
An12g01580
Definition
(RefSeq) D-3-phosphoglycerate dehydrogenase
Organism
ang  Aspergillus niger
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 Rossmann-like AdoHcyase_NAD IlvN
Other DBs
NCBI-GeneID: 4985508
NCBI-ProteinID: XP_001395245
UniProt: A2QYK6
AA seq 323 aa
MAPSRDDDLVSSRQTTADKPTVYLLDTFPPKAIEHAKTLFNIIQPQDEEFQNWRQNARAL
LIRSSYLTAEDVASCPNLIAIGKHGVGIDKIDQAACAERGIKILNTPGANARDVAELVIA
LSLSVARGIRSITTRQMSKPVPKETCKGLTLYQKTVGIIGMGNIGRTVAEIFRGGFETDI
IAYDAYMPDDIWTHIPHTRANSVDEVITRADILSIHVPLTNETRDMISYDKICMMKPDAI
LINAARGGIVNEQDLTRALSEGHLWGAGLDCHEQEPPSFEKYGQLWENLNVISTPHIGAA
TSRAQLASATAAIDNLHKYLSSL
NT seq 972 nt   +upstreamnt  +downstreamnt
atggcacccagcagggacgatgacttggtttcttcccgccagactactgcggataaacca
acagtgtatctccttgacacattccctccaaaggcaatcgagcacgccaaaacactcttc
aacattatccaaccccaagatgaagagttccagaactggagacagaatgcacgagctttg
ttaatccgaagttcgtatcttactgccgaagacgttgccagttgtccgaatctcattgcg
atcggcaagcacggagtgggcattgataagatcgaccaagccgcttgcgctgaaagaggc
atcaagattcttaatacacctggagcaaacgcacgcgatgtggctgagctggtcattgct
ctttctctgtcggttgctcgtggcattcggtccatcacaacacgccaaatgtcaaagccc
gtcccaaaggagacctgcaaggggctgacgttgtaccaaaagactgttggaattattggc
atgggaaatattggacggaccgtcgccgagatttttcggggtggcttcgagaccgacatc
atcgcatatgatgcctatatgccggacgacatatggacgcacatcccccacaccagagcc
aacagcgtcgatgaagtcatcactcgggcagatatcctctctatacatgtccctcttaca
aacgagacacgggacatgatttcctacgacaagatttgcatgatgaagccggatgccatc
ctgatcaatgcggctcggggagggattgtcaatgaacaggacctcacacgagcattatct
gaaggccatctttggggtgctggcttggactgccacgaacaggagcctcccagctttgag
aaatatggtcaactgtgggaaaacctgaatgtgatcagtacaccgcacattggagctgcg
acgtcaagggcacaattagcgagtgccactgcggcaattgacaatttgcacaagtaccta
tctagtctgtga

DBGET integrated database retrieval system