KEGG   Aspergillus niger: ANI_1_230154Help
Entry
ANI_1_230154      CDS       T01030                                 

Gene name
An17g01670
Definition
(RefSeq) succinyl-CoA ligase [GDP-forming] subunit alpha
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
ang  Aspergillus niger
Pathway
ang00020  Citrate cycle (TCA cycle)
ang00640  Propanoate metabolism
ang01100  Metabolic pathways
ang01110  Biosynthesis of secondary metabolites
ang01130  Biosynthesis of antibiotics
ang01200  Carbon metabolism
Module
ang_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ang_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANI_1_230154 (An17g01670)
   00640 Propanoate metabolism
    ANI_1_230154 (An17g01670)
Enzymes [BR:ang01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     ANI_1_230154 (An17g01670)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ANI_1_230154 (An17g01670)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 4989490
NCBI-ProteinID: XP_001398396
UniProt: A2R9J7
AA seq 332 aa AA seqDB search
MQAVRRNTVAALRNAAATQRRAYSASASPAYAETVNNLRINGDTKVIFQGFTGKQGTFHA
EQAIAYGTKVVGGTNPKKAGSMHLDRPVFANVSEAVKETGATATALFVPPPLAAKGIEEA
IEAEIPLAVCITEGIPQHDMVRITDILKTQNKTRLVGPNCPGIIAPGQCKIGIMPGFIHK
RGRIGIVSRSGTLTYEAVNQTTQAGLGQSLVVGIGGDPFSGTNFIDCLKIFLEDEETDGI
IMIGEIGGSAEEDAAEFLKANNKYNKPAVGFIAGISAPPGRRMGHAGAIVSGGKGGADSK
IAALEAAGVVVERSPASLGKALLNEFVKRDLV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccgtccgccgtaacaccgtcgctgcccttcgcaatgctgctgccacgcagcgc
cgggcatactctgcctcggccagcccggcttacgctgagactgtgaacaaccttcgcatt
aatggagacaccaaggttatcttccagggtttcactggaaagcagggaactttccacgct
gagcaagctatcgcctatggcaccaaggtcgttggtggaaccaacccgaagaaggccggc
tcgatgcaccttgaccgtcccgtcttcgcgaacgtgagcgaggccgttaaggagactgga
gctaccgctactgctctcttcgtccccccccccttggccgctaagggtatcgaggaggcc
atcgaggccgaaattcctctggctgtctgtatcaccgagggtatccctcagcacgacatg
gttcgtatcaccgatatcctgaagacgcagaacaagacccgtctggtgggtcctaactgc
cctggtatcatcgctcctggccaatgcaagattggtatcatgcctggattcattcacaag
cgtggacgtatcggtattgtgtctcggtccggtaccctgacctacgaggccgtcaaccag
accacccaggctggtcttggtcagtccctggtcgtcggtatcggtggtgaccccttctcc
ggcaccaacttcatcgactgcctgaagatcttcctcgaggacgaggagaccgacggtatc
atcatgattggtgagatcggtggtagcgccgaggaggatgctgccgagttcctcaaggcc
aacaacaagtacaacaagcccgccgttggtttcatcgccggcattagcgctcccccgggc
cgtcgtatgggtcacgccggagccatcgtcagcggcggcaagggtggcgctgactctaag
atcgccgctctcgaggcggctggtgttgttgtcgagcgcagccccgcttccctgggcaag
gccctcctgaacgaattcgtcaagagggacctggtctag

DBGET integrated database retrieval system