KEGG   Aspergillus niger: ANI_1_2316014Help
Entry
ANI_1_2316014     CDS       T01030                                 

Gene name
An01g02000
Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
ang  Aspergillus niger
Pathway
ang00350  Tyrosine metabolism
ang00360  Phenylalanine metabolism
ang00380  Tryptophan metabolism
ang00901  Indole alkaloid biosynthesis
ang01100  Metabolic pathways
ang01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    ANI_1_2316014 (An01g02000)
   00360 Phenylalanine metabolism
    ANI_1_2316014 (An01g02000)
   00380 Tryptophan metabolism
    ANI_1_2316014 (An01g02000)
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    ANI_1_2316014 (An01g02000)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ang04147]
    ANI_1_2316014 (An01g02000)
Enzymes [BR:ang01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     ANI_1_2316014 (An01g02000)
    4.1.1.105  L-tryptophan decarboxylase
     ANI_1_2316014 (An01g02000)
Exosome [BR:ang04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ANI_1_2316014 (An01g02000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 4977430
NCBI-ProteinID: XP_001388638
AA seq 516 aa AA seqDB search
MDREQFREAAHSAIDDIINYFDDLPNQRVVPTIEPGYLRPLIPTSPPENPEPWSAIQSDI
ETKIKPGITHWQSPNFMAFFPAGVTYPSILGEMYSAAFTAPAFNWLCSPACTELETIVMD
WLAQALALPECFLSTSENRGGGVIQVTASDTVATMMIAARERRVTEMVVSEGFKPDTVEY
EDRMMELRSRLVALASNQAHSSTAKGALLAGTRFRSVEARLEDNLEMTGERLRTVLEGLD
RDKLTPYFITLGLGTTNSCAVDRFREIKAVLAEKEHWKRIWVHIDAAYAGAALVADEWQY
ISKEFAEGVDSFNMNMHKWLLVNFDASCLFIRNREDLTNALDITPAYLRNHYSDSGKVTD
YRNWSMSLGRRFRALKIWFVMRSYGLTGMKDYIRKSIGLGETFAGLVRGRADLFDIITTP
AFGLTVFRIKSPKSGTTMVEADNGVLVAQPDEAANELTKEVYELVNSRGEIFITSTVVCG
VYAIRVVSTNPAAEEKYVKRAFEILVETAEEIIKRG
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcgaacagttccgggaggccgcccactcggccattgacgacataattaactac
ttcgatgacctcccaaaccagcgcgttgtccccaccatcgaaccaggctaccttcgtccc
ctaatcccgacctcaccccccgagaatcccgaaccatggagcgccattcaatccgacatc
gaaaccaagatcaagccgggcatcacccactggcaatcccccaacttcatggccttcttc
cccgcaggtgtcacctaccccagtattctgggcgaaatgtacagcgcagcattcacagcg
cctgcgttcaactggctctgctccccggcgtgcacggaactcgagaccatcgtgatggat
tggctcgctcaggcccttgcattgccggaatgtttcctcagcacgtcggagaaccgcgga
gggggcgtaattcaggttacggcaagtgatacggtcgcgacgatgatgattgctgcaagg
gagagacgggtgactgagatggtggtgagtgaggggttcaagcctgatacagtggagtat
gaggatcggatgatggagttgaggagtcggttggtggctttggcgagtaaccaggcgcat
agcagtacggcgaagggggcgttgttggcgggaacgaggttcaggagtgttgaggcgagg
ttggaagataacttggagatgaccggggagaggttgagaactgttttggaggggttggat
cgtgataagctgacgccttattttattaccttgggattggggacgacgaattcgtgtgcc
gttgatcggttcagggagatcaaggctgtgttggccgagaaggaacattggaagaggatt
tgggtccatattgatgctgcttatgcgggtgcggcgctggtcgcggatgagtggcagtat
atttcgaaggagtttgccgagggcgtcgacagctttaacatgaatatgcataagtggctg
ttggttaactttgatgctagctgcctcttcatccgcaaccgcgaagacctcaccaacgcc
ctcgacattacccccgcctacttgcgtaaccactactccgattccggcaaagtgaccgac
taccgcaactggagcatgtccctgggccgccgattccgcgccctaaaaatctggttcgtc
atgcgcagctacggtctcaccggtatgaaggactacatccgcaaatctatcggattgggc
gagacctttgcaggtctggtgcgcgggcgcgccgacctgtttgatattatcaccacgcct
gcattcgggttgactgtgttccgcatcaagagtcccaagtcagggacgacgatggtggaa
gctgacaatggggtccttgttgcgcagccggatgaggcggcgaatgagctcacgaaggag
gtgtatgagctggtgaactcacggggagagatctttattacatcgacggttgtttgtggg
gtttatgccattcgggttgtgagtacgaatccggcggccgaggagaagtatgtgaagcgg
gcatttgagattttggtggagacggcggaggagatcattaagcgggggtag

DBGET integrated database retrieval system