KEGG   Aspergillus niger: ANI_1_2324024Help
Entry
ANI_1_2324024     CDS       T01030                                 

Gene name
An02g02290
Definition
(RefSeq) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
ang  Aspergillus niger
Pathway
ang00250  Alanine, aspartate and glutamate metabolism
ang00330  Arginine and proline metabolism
ang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ANI_1_2324024 (An02g02290)
   00330 Arginine and proline metabolism
    ANI_1_2324024 (An02g02290)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     ANI_1_2324024 (An02g02290)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 4978715
NCBI-ProteinID: XP_001399370
UniProt: A2QC50
AA seq 571 aa AA seqDB search
MRTLSFPLRVRASILHTSRRAGQPLRALSLWHPPKFENEKPLDYAKGSPERAELTQALQK
LKSEMPFNIPLTINGSTTQTIKSQVQQNPSRHNEVVAEYASATPEQVNTAVDAALKAKPA
WEAMPFEDRAAIFLRASELIAGRYRSEIVAATMLGQGKNIWQAEIDAAAETVDFFRHYIQ
ECWSLFAQQPKVHLPGTWNKLEYRPLEGFVYAIAPFNFTALGATLIGPAALLGNVVIWKP
SDSALHASWLLHQILLEAGLPKDVIQFLPGDAEQVTNTILHRPEFGALTFIGSTQVFKGL
QKKIGNAIGEGIYNSYPRVIGETGGKNWGLVHPSADITNAALNTIRGAFEYQGQKCSANS
RIYVAESVWPAFQQTLKDHLSRLSVGPVDEYAHFINPVIHERAFDRLAEVIHAARTDPEL
ELVAGGIADKSQGYYVHPTVYRTTNPKHEIMSRELFGPILGVYVYPDNEWEETLKLVDGT
SRYALTGSIYAKDPYASRQAQTALRHAAGMLYLNTKCTGSTVAQQPFGGSRDSGTNDKTG
TMAHLQRFVSVRTIKEEFGSLEEVEYPSNVV
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgcggacactctcctttccacttcgcgtgcgcgcctcaattctgcacaccagccggagg
gcaggtcagccgctgcgagccctgagtctatggcatcctcccaagttcgagaatgagaag
ccacttgactacgcaaaaggctcacctgagagggccgagttgacgcaagccctacagaaa
ttgaagagcgagatgcccttcaatatcccactcaccatcaatggctccacaacacaaacc
atcaaatcccaagtccaacagaacccctcacgccacaacgaggtcgttgccgaatatgca
tccgcaacgcccgagcaggtcaacaccgccgtggacgcagccctcaaggccaaaccagcc
tgggaggccatgcccttcgaggaccgcgccgccatcttcctgcgcgcctctgagctcatt
gcaggcagatatcgctctgaaatcgtcgctgctaccatgttaggccagggaaagaacatt
tggcaagccgagatcgatgccgccgccgagacagtggacttcttccgccactacatccaa
gagtgctggtcactcttcgcgcagcagcccaaagtccacctgcccggcacctggaacaag
ctcgaataccgacctttggaaggatttgtctacgccatcgccccattcaacttcaccgca
ctaggcgcgaccctcatcggcccagccgccctcctaggcaacgtcgttatctggaaaccg
tccgactctgccctccacgccagctggctcctgcaccagattctcctcgaagccggtctc
cccaaggacgtaatccagttcctccccggcgacgccgaacaagtaaccaacacgatcctc
caccgccccgaattcggcgccctcaccttcatcggctccacgcaagtcttcaaaggcctg
cagaagaagatcggcaatgccatcggcgagggaatttacaactcctacccacgtgtgatc
ggtgaaactggtggcaagaactggggtctcgtgcacccctcagcggacatcaccaacgca
gccctgaacaccattcgtggcgcgttcgaataccagggccagaaatgctccgccaattcc
cgcatctacgtcgcagaatccgtctggcctgctttccagcaaacgttaaaggaccacctc
tcccgcctgtctgtcggcccggtcgacgaatacgcccacttcattaaccccgtcatccac
gaacgcgccttcgaccgtcttgcggaggtcattcacgccgcgcgcaccgatcccgaactc
gaactcgttgctggcggcatcgccgacaagagtcagggatactacgtacacccgactgtt
taccgcacaacgaacccgaagcatgagatcatgtcccgggaactattcggccccattcta
ggcgtatacgtgtacccagacaatgagtgggaggaaacgctgaagctagtggacgggaca
tcgcgctacgccttgacggggagtatctatgcgaaggacccatacgcgtcgcgacaggcg
cagacagcgctgcgtcatgcggcgggcatgctgtatctgaatacgaagtgtacgggttcg
acggtcgcgcagcagccgtttggaggaagtcgagattccggaacgaatgacaagacgggc
acaatggcgcatttgcagcggttcgtgagtgtcaggacgattaaagaggagtttgggagc
ttggaggaggtggagtatccttctaatgttgtgtga

DBGET integrated database retrieval system