KEGG   Aspergillus niger: ANI_1_3272014Help
Entry
ANI_1_3272014     CDS       T01030                                 

Gene name
An01g13620
Definition
(RefSeq) glutathione synthetase
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
ang  Aspergillus niger
Pathway
ang00270  Cysteine and methionine metabolism
ang00480  Glutathione metabolism
ang01100  Metabolic pathways
Module
ang_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ANI_1_3272014 (An01g13620)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ANI_1_3272014 (An01g13620)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ang04147]
    ANI_1_3272014 (An01g13620)
Enzymes [BR:ang01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     ANI_1_3272014 (An01g13620)
Exosome [BR:ang04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ANI_1_3272014 (An01g13620)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase
Motif
Other DBs
NCBI-GeneID: 4977127
NCBI-ProteinID: XP_001389763
AA seq 520 aa AA seqDB search
MYPPATPEMQGHHLITQILNYQLTHGMHLKHINLAQPSHSTSSYPISTSIFPTPFPRALF
HDAQHTLQPIYNELYARLSDNEPWLYEKVIRPLLPVDPFARILWEIHIRITNEGEGGGYG
SDVSMGLFRSDYMLHISLDESENAKHGLQLKQVEFNTIACAGGCHANKVVDMHRYLTRTG
VYISLSDANEGKGESPITLSSLPTNGNIKGLADSLAVAHGMYGPARCSLAAEAGVLFIVQ
PNNFNVADELPIEYALWNRDIPVPTYRVEWGDDVLERTCLSNTRELLFYPHLQGEGSRGK
GQPVEISVVYFRAGLEVHEYDATGIECRVRLEQSRAIKCPSLLGHILTFKKVQQVLMGPG
VLERFLDTEEKVSVIRDTFVSMYPMDGDSEEGRYARRLATNPDTAWKYILKPSLEGGGHN
IYGEDIPGFLLGMSSESEWGRYVLMERIRSPVVGNVLMSREGVEESDVISEVGVFGLCIW
KKGEILRNETVGWSLKTKFADVDEMSVVKGFGCFDTPLLV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtacccccccgcgacccccgaaatgcaaggccaccacctaatcacccaaatcctcaac
taccaattaacccacggcatgcatctcaaacacatcaaccttgcccaaccctcccacagc
acatccagctaccccatctccacgagcatcttccccacccccttccccagggccctgttc
cacgacgcgcaacataccctccaaccaatctacaacgaactatacgcccgtctctcagac
aacgagccctggctctatgagaaagtcatcaggcctcttctccctgtcgatccctttgcc
aggatattatgggagattcatattcggataacgaatgagggagaaggagggggatacggg
tcagatgtatcaatggggttgtttcggtcggattacatgcttcatattagccttgatgag
agtgaaaatgcgaagcatgggctgcaattgaaacaagtcgaattcaacaccatcgcgtgc
gcgggaggctgtcatgcgaataaagtggtggatatgcatcggtatttgacgaggacggga
gtttatatatctttatcagatgcgaacgagggaaaaggggagagtccgattacgctgtca
tcgttacctacgaatgggaatatcaaaggcctggctgattctctcgcggtggcgcatggt
atgtatggcccggctaggtgcagtctcgctgctgaggcaggggtgcttttcatagtccag
ccgaacaacttcaacgttgctgatgaactgcctattgaatatgcactctggaatagggat
attcctgtcccgacgtatagggttgagtggggggatgatgtgctggaaaggacttgtctt
agcaatacgcgggaattgctgttttatccgcatttgcaaggtgaaggtagcagagggaaa
ggacagccggtggaaatatcagtcgtgtatttccgtgcggggctcgaagtgcacgagtat
gatgccacggggatagaatgtcgagtcaggcttgagcagtcgcgggctatcaagtgtccg
tcgttgctgggacatatattaacgtttaagaaagtgcagcaagttcttatgggtccgggg
gtgttggagaggtttcttgatactgaagagaaagtgtcggttattagagatacatttgtg
tctatgtacccgatggacggtgattctgaggaaggacgctatgcgcgcaggctagcgacg
aatcctgataccgcgtggaagtatattttgaaaccgtcgttggaaggcggggggcataat
atctacggggaggatatcccggggtttctgttgggaatgagttcggaatccgaatggggt
aggtatgtgttgatggagaggattaggtcgcctgttgtggggaatgtgctgatgtcgcgg
gaaggggtggaggaatcggatgtgatttcggaagtgggggtgtttgggctgtgtatttgg
aagaagggggagattttgagaaatgaaactgtgggctggtcgttaaagacgaagtttgcg
gatgtggatgagatgagtgtggtcaaggggtttgggtgctttgatacgccgttgttggtt
tga

DBGET integrated database retrieval system