KEGG   Aspergillus niger: ANI_1_348154Help
Entry
ANI_1_348154      CDS       T01030                                 

Gene name
An17g02330
Definition
(RefSeq) D-3-phosphoglycerate dehydrogenase 1
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
ang  Aspergillus niger
Pathway
ang00260  Glycine, serine and threonine metabolism
ang00680  Methane metabolism
ang01100  Metabolic pathways
ang01130  Biosynthesis of antibiotics
ang01200  Carbon metabolism
ang01230  Biosynthesis of amino acids
Module
ang_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ANI_1_348154 (An17g02330)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANI_1_348154 (An17g02330)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ang04147]
    ANI_1_348154 (An17g02330)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     ANI_1_348154 (An17g02330)
    1.1.1.399  2-oxoglutarate reductase
     ANI_1_348154 (An17g02330)
Exosome [BR:ang04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ANI_1_348154 (An17g02330)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2 AdoHcyase_NAD XdhC_C DUF1780
Motif
Other DBs
NCBI-GeneID: 4989558
NCBI-ProteinID: XP_001398464
AA seq 474 aa AA seqDB search
MATSARDINAREGSNLNPSQSLNFSTSPTASFQSAPSSHGGSAFGSRTIPLANAKHLKPF
ATEDIKVLLLENVNQTGRDILTKQGYQVEFLKSSLPEDQLIEKIRDVHVIGIRSKTKLSA
RVLKEARNLIVIGCFCIGTNQVDLQFAAEHGIAVFNSPFSNSRSVAELVIAEIIALARQL
GDRSNEMHNGTWNKVSNKCWEIRGKTLGIIGYGHIGAQLSVLAEAMGMSVIFYDVVNLMA
LGTARQVPTLEILLSESDFITCHVPELPETRNMIGQRQFEQMKSGSYLINASRGSVVDIP
ALIHAMRSGKVAGAALDVYPNEPAGNGDYFNQSLNDWATDLRGLKNLILTPHIGGSTEEA
QRAIGVEVAEALVRYVNEGTTLGAVNLPEVALRSLTMDEPDHARVIFIHQNVPGVLRKVN
EILGDHNVDKQMTDSRGDVAYLMADISSVDNTTIKDLYERLESLGSRIMTRILY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggctacgtctgcaagggacataaatgcccgagagggatcaaatctcaacccttcacaa
agcttgaatttctctacctctcctaccgcttctttccagtctgctccatccagccatggt
ggctcggcttttggaagccgtacgatacctctagcaaatgcaaagcatttgaaaccgttc
gccacggaggatattaaggtcttgcttctggaaaacgtcaaccaaacgggtagggacatc
cttaccaaacagggctatcaggtggaatttcttaaatcttcccttccggaagatcagctc
attgagaaaattcgagatgtacatgtgattgggattcgatcgaagaccaagctgagtgct
cgtgttttaaaggaagctcggaatctcattgttattggttgtttctgcattggaacgaac
caggttgatctacaatttgcagctgaacatggaattgcggtcttcaactcaccgtttagc
aactcccgtagtgttgcagaattggttatagctgaaatcattgctcttgcccgtcaactg
ggtgaccgttccaatgagatgcataacggcacatggaacaaagtgagcaacaagtgctgg
gaaattcgcggaaagacccttggtataatcggatatggccatattggcgctcaactgtct
gttctagcagaggctatgggcatgtcagttattttctacgacgtagtgaacctgatggca
ttgggtactgctcgccaagtaccaacccttgagatcctcttgtctgagtcagactttatc
acgtgccatgttcctgagctcccagaaacacggaacatgataggacaacgccagtttgag
caaatgaagtctggtagttatttgataaatgccagtcggggaagtgttgtggacattcct
gctctaatccatgcaatgcggtccgggaaagtggcgggtgctgctctcgatgtctatccc
aatgagccagctggaaatggtgattatttcaatcaaagcctcaatgactgggcaacggat
ctcaggggacttaagaacttgatcctcacgccacatattggaggtagcacagaggaggcg
cagcgtgcgattggcgttgaggtcgcagaagccttggtgagatatgttaatgaaggcaca
acactgggggccgtaaacctgccggaagttgctctgcggtccctgacgatggacgaaccc
gaccatgcccgagtcatcttcattcatcagaacgttccgggtgttttgcgaaaagttaat
gagatccttggcgatcacaatgttgacaagcaaatgaccgatagcagaggcgatgtggcc
tacttgatggccgatattagcagtgtcgacaacacgacaatcaaggacttgtacgaaagg
cttgaaagcctcggatctcgaattatgacgcgtatcttgtattaa

DBGET integrated database retrieval system