KEGG   Aspergillus niger: ANI_1_444064
Entry
ANI_1_444064      CDS       T01030                                 

Gene name
An07g03620
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
ang  Aspergillus niger
Brite
KEGG Orthology (KO) [BR:ang00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ang01009]
    ANI_1_444064 (An07g03620)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     ANI_1_444064 (An07g03620)
Protein phosphatases and associated proteins [BR:ang01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     ANI_1_444064 (An07g03620)
SSDB
Motif
Pfam: Metallophos PHD20L1_u1
Other DBs
NCBI-GeneID: 4981629
NCBI-ProteinID: XP_001391445
UniProt: A2QMX2
AA seq 560 aa
MDRTIARAVTDKKPVPEIDFTLHVMEDGTQVSTLERVIKEVQAPALNTPPDDLFWSREDP
SKPNLQFLKQHFYREGRLTEDQALWIIQAGTQLLRAEPNLLEMDAPITVCGDVHGQYYDL
MKLFEVGGDPSETRYLFLGDYVDRGYFSIECVLYLWALKIWYPNTLWLLRGNHECRHLTD
YFTFKLECKHKYSERIYEACIESFCSLPLAAVMNKQFLCIHGGLSPELHTLEDIKAIDRF
REPPTHGLMCDILWADPLEDFGQEKTGDYFIHNSVRGCSYFFSYPAACAFLEKNNLLSII
RAHEAQDAGYRMYRKTRTTGFPSVMTIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCTP
HPYWLPNFMDVFTWSLPFVGEKITDMLIAILNTCSKEELEDDTPTSVSPTAAPPSPPAAM
DVESSEFKRRAIKNKILAIGRLSRVFQVLREESERVTELKTAAGGRLPAGTLMLGAEGIK
QAITNFEDARKVDLQNERLPPSQEEVIRRSEEDRRIALERAHHEAENDAGLATVARRISM
SAGSGKTRRQRDATRDSREA
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggatcgcactatcgcgcgtgcggtgacggataaaaagccggtcccggagatcgacttt
acgttacatgttatggaagatggcactcaggtgtcgaccttggagcgagtaattaaagag
gtgcaagcgccggcgttgaacaccccgccggacgacctgttctggtctcgtgaagaccct
tcaaagcccaacctgcagttcctcaagcagcacttctaccgcgaaggtcgtctcactgaa
gatcaggcgctatggatcatacaggccggtactcagcttctcagggctgaacccaacctg
ctggagatggatgcgcccatcaccgtgtgcggtgatgttcacggacaatattacgattta
atgaagctcttcgaagtcgggggagatccgtccgagacgcgctatctcttcctcggtgat
tatgtggatagaggttacttcagtattgagtgtgtcctgtatctctgggctctgaagatc
tggtatccgaatacgctttggctcctgcggggtaatcacgaatgtcggcacttgacggac
tacttcacctttaagctcgagtgcaagcacaaatacagcgagcgcatttacgaggcttgc
attgaatcgttttgctccttgccgctggcggcggtcatgaataagcagttcctctgtatc
catggaggtctcagccccgagctgcacactctggaagacatcaaggcgattgatcgcttt
agggagcccccgactcatggcttgatgtgcgacatcctctgggccgatcctctggaagac
tttgggcaggagaagactggagattacttcatccacaacagcgtccgcggatgctcgtat
ttcttttcgtaccccgcggcgtgcgcgttcctcgaaaagaacaatctcctctccatcatt
cgtgcgcacgaggcacaagatgccggttaccgcatgtaccgcaagacacgtacgaccggt
ttccccagtgtcatgaccatcttcagtgctcccaactacctggatgtctacaacaacaag
gccgccgtcctgaaatacgagaacaacgtcatgaatatccgacagttcaactgcacgcct
cacccgtactggctccccaacttcatggacgtcttcacctggtctcttcccttcgtcggt
gagaagattacggacatgcttattgccattctcaacacctgctctaaggaggagcttgaa
gatgatacccccacgtcggtctcgcccaccgccgcacccccctctcctcctgcagcgatg
gatgttgagagcagcgagttcaagcgacgtgcgatcaagaacaagattcttgccattgga
cgtctgtcgcgtgtattccaggtgttgcgtgaagagtccgagcgggtcactgaactcaag
accgctgctggaggtcgtctcccggcgggtactctgatgctgggagcggagggtatcaag
caggctattaccaacttcgaagatgctcgcaaggtcgatctgcagaatgaacgtctgccc
ccttcgcaggaggaggtcattcgacgcagcgaggaagacagacgcattgcccttgagcgg
gcgcatcatgaggcagaaaacgatgccgggctggcaactgtggccaggcggattagcatg
tcggcgggatcgggcaagactcggcgacaaagggatgctactcgggactctcgagaagca
tga

DBGET integrated database retrieval system