KEGG   Aspergillus niger: ANI_1_446164
Entry
ANI_1_446164      CDS       T01030                                 

Gene name
An18g03480
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ang  Aspergillus niger
Pathway
ang00100  Steroid biosynthesis
ang01100  Metabolic pathways
ang01110  Biosynthesis of secondary metabolites
Module
ang_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    ANI_1_446164 (An18g03480)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     ANI_1_446164 (An18g03480)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 4989912
NCBI-ProteinID: XP_001398810
UniProt: A2RAK8
AA seq 497 aa
MAPKKDSKTKVRVQPVPEKRGYEFGGPLGAFGIVFGLPVLVYSFTFLCNDVSGCPAPSLL
HPSTVTLDQLKAEVGWPKGGFADFYDTSVTLWVLGYYLLSLAMYVFLPGQEVEGTELACG
GRLPYKFNAFLSAVLILSGCATGTYIYGADFAVWTFLWDNYLQVITANLVICTVISIFVY
AKSFTVPAPGQPNPELRQLAPGGHTGNALYDFFIGRELNPRVRLPIPFVSEASRTIDIKS
WLEMRPGLLGWIILNLSNIARQYRTYGYITDSIVISTAFQAFYVLDGLYMEPALLTTMDI
IMDGFGFMLSFGDLVWVPFIYNFQTRYLAVFPYELGFNGILLVLAVTAVGYSIFRGANNQ
KNRFRTNPNDPRVKHLKYIQTASGSKLITSGWWGSARHINYLGDWVMSWSYCLPTGIAGY
AIIQTINPATGDLQKQAVQTPESRGWGMIFTYFFLVYFGTLLIHREQRDEEKCKRKYGAD
WDRYTSLVRSRIIPGIY
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggctcccaagaaggactccaagaccaaggtccgggtgcagcccgttccagagaaacgc
ggctatgaattcggaggccctctcggtgcgttcgggatcgtgtttggtctgcccgtgctg
gtttacagcttcaccttcctgtgtaacgatgtctccggctgcccggcaccttcgttacta
cacccttctaccgtgacgcttgaccaattgaaggcagaggttggctggcccaagggaggt
tttgcggatttttacgacacaagcgtgacactctgggtcttgggctattatctgcttagc
ttggcgatgtacgtgttcctgcctggccaggaggtcgagggcactgaattggcgtgtgga
ggaagattgccctacaagttcaacgcttttctgtcggccgtcctgatcctctccggctgt
gcgacgggcacttacatctacggcgcggactttgctgtctggacttttctctgggacaac
tatctgcaggtaatcaccgccaacctggtgatctgtactgtcatctccatcttcgtctat
gcgaagagcttcactgttcctgcccctgggcagcccaaccctgagctccgccagctagct
ccgggtggccacactggcaacgcgttgtatgatttcttcattggccgagagctgaacccc
cgggtacgcctgccaattcccttcgtcagcgaagcttcgcgcacgatcgatatcaagtcc
tggctcgaaatgcgccccggcttgctggggtggatcatcctgaacttgtcgaacattgcc
cgccagtaccgcacctacggctacatcacggactcgatcgtcatctcgactgcgttccag
gcgttctacgtcctggatggcctgtacatggagcctgccctgctgactactatggacatt
attatggacggcttcgggttcatgctctcatttggcgacctcgtctgggtcccttttatc
tacaacttccagactcgctacctggccgtctttccgtatgagctgggtttcaatggcatt
ctgctcgtcctggccgtcaccgctgtgggctactcgatcttccggggcgccaacaaccag
aagaatcggttccgcaccaacccgaacgacccccgcgtcaagcacctcaagtacatccag
acggctagtggctccaagctgatcacgtctggctggtggggaagcgcccgccacatcaac
tacctgggcgactgggtcatgtcgtggtcgtactgcctgcctacgggcattgccggctac
gctattattcagactatcaacccggccaccggggatctgcagaagcaggcagtgcagacc
cccgagagccgaggctggggaatgatctttacttacttcttcctggtgtactttggcacg
ctgctgatccaccgcgagcagcgggacgaggagaagtgcaagcgcaagtacggagccgac
tgggaccggtatacgtcgttggtccgcagccggatcattcctggcatttactaa

DBGET integrated database retrieval system