KEGG   Aspergillus niger: ANI_1_464184Help
Entry
ANI_1_464184      CDS       T01030                                 

Gene name
An04g02230
Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ang  Aspergillus niger
Pathway
ang00450  Selenocompound metabolism
ang00970  Aminoacyl-tRNA biosynthesis
ang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ANI_1_464184 (An04g02230)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ANI_1_464184 (An04g02230)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ang01007]
    ANI_1_464184 (An04g02230)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ang03016]
    ANI_1_464184 (An04g02230)
Enzymes [BR:ang01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ANI_1_464184 (An04g02230)
Amino acid related enzymes [BR:ang01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ANI_1_464184 (An04g02230)
Transfer RNA biogenesis [BR:ang03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ANI_1_464184 (An04g02230)
 Prokaryotic type
   Other AARSs
    ANI_1_464184 (An04g02230)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 4990628
NCBI-ProteinID: XP_001401591
UniProt: A2QI45
AA seq 575 aa AA seqDB search
MAISRAGFRAASWTGQFLACSRPSWRCVPRATARPATTIRPRRFATAASESASKKPYYVT
TPIFYVNAAPHVGHLYTMVLADVIKRWRTLIGDADAQLLTGTDEHGMKIQQAALAAEMDT
QAFCDMNYKTFEALANAANMDYNYFIRTTEPAHKEAVQYFWEVLEHRGYVYTAKHEGWYS
VSDETFYPQTQVQKSLDPETGHTKMVSIETGKEVEWSSETNYHFRLSAFQERLLDLYKTG
FITPTMYTTNVVKSVSEGLQDLSISRPAERLTWGIPVPGDNTQTVYVWLDALVNYLTKAG
YPFAPGQGSHLGWPADVHVVGKDIVRFHCVYWPAFLMALDLPLPRNVLVHGHWTMNREKM
SKSTGNVVNPFFAINRFGVDSMRFFLIHQGALVGDADYDNAYIIRDYQKLLQKGLGNLAH
RAIGCAKGNLRTYIENGTCGRLPPATPADEAYETMLKDVPKRIAEQMENLNPRAALQEIT
TLIDQTNKYFHHAEPWKSPNDRQRSIFNVAESLRMAGILLQPVMPTKANELLDMFHVDRT
DPAKRSYAAATYGSDADYGVDAKKSILFPPLIVES
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggctatctcgagggcaggttttcgtgcggcatcttggaccggccaattcctggcctgc
agtcgcccatcttggagatgcgtcccccgcgcaactgcccgcccagcgacaacgatccgt
ccgcgtcgattcgcaacggcggcctcggaaagcgcttctaagaagccatactatgtcacg
acacccattttctatgtcaacgctgcccctcatgtcggtcatctgtatactatggtcctt
gccgatgtcatcaagagatggcggactctcatcggagacgctgacgcacaattgctgacg
ggaacggacgaacatggcatgaagattcagcaggccgcgttggctgcggagatggatacg
caggcgttctgcgacatgaattacaagacgtttgaggctctagcaaatgctgcgaatatg
gactacaattactttatacggacaactgaacctgcgcacaaggaagctgttcagtatttt
tgggaagtgttggagcaccggggatacgtttacaccgcgaagcacgaaggctggtactcg
gttagcgatgagacattctaccctcagacgcaagtacaaaagtcgctggaccccgagact
gggcataccaagatggtctccattgagacaggaaaggaggtggagtggtcgtcggaaacc
aactaccatttccgtctgtcagctttccaggaacgtttgctcgatctatacaaaactgga
ttcattaccccgacgatgtatacaaccaatgttgtcaaatctgtttccgaaggccttcaa
gacttgtcaatctctagacctgcggagcggctgacctggggtattccggttcccggcgac
aacacacagaccgtctatgtctggctagatgcgcttgtcaactacttgaccaaggcaggc
tacccgtttgcacccggccaaggaagccacctcggttggcctgcggatgtgcatgtcgtc
ggtaaggatattgttcgctttcactgcgtatactggcccgcattcctcatggctcttgac
cttcctcttccccgcaatgtactcgttcatggacattggactatgaaccgtgagaagatg
tcgaagtctacgggtaatgtggtgaaccccttctttgccatcaaccgcttcggggtggat
tccatgcgtttcttcctcatccaccaaggtgcattggtgggcgacgccgactacgataat
gcttacatcatccgcgactatcagaagctactgcagaaggggctcggaaaccttgcacat
cgggcaatcggctgtgccaagggtaatcttaggacttacatcgagaatggcacgtgcggc
agacttccaccagcgactccggccgatgaggcgtacgaaacaatgctcaaggatgtaccc
aagaggatagcagagcaaatggaaaatctgaacccccgtgctgccctgcaagaaatcact
accttaatcgatcagaccaacaaatacttccaccacgcagaaccatggaagagcccgaac
gaccgccagcgatcgatcttcaatgtcgccgaatcactgcgaatggccggtatcctcctg
cagcctgtcatgcccaccaaggccaacgagcttctggacatgttccacgtagacagaacg
gacccggccaaaaggagctatgcggcggcgacgtacggctccgacgcagactacggagtg
gatgctaaaaagagtatcctatttccccctcttatcgtggaaagttaa

DBGET integrated database retrieval system