KEGG   Aspergillus niger: ANI_1_510124Help
Entry
ANI_1_510124      CDS       T01030                                 

Gene name
An14g03500
Definition
(RefSeq) dihydroxyacetone synthase
  KO
K17100  dihydroxyacetone synthase [EC:2.2.1.3]
Organism
ang  Aspergillus niger
Pathway
ang00680  Methane metabolism
ang01100  Metabolic pathways
ang01200  Carbon metabolism
Module
ang_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ANI_1_510124 (An14g03500)
Enzymes [BR:ang01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.3  formaldehyde transketolase
     ANI_1_510124 (An14g03500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C E1_dh PepSY_2
Motif
Other DBs
NCBI-GeneID: 4987206
NCBI-ProteinID: XP_001400975
UniProt: A2R395
AA seq 708 aa AA seqDB search
MAVGPVPQSNGASALPLVRQLSKDHDHVLKSFRLLISDLCQQFGGGHPGGAIGMAAIGVA
LWRYVMQYAPHSPDYFNRDRFILSNGHTCLFQYAFLHLTGYKAMTFEQLKSYHSDRVDAL
CPGHPEIEHEGIEVTTGPLGQGVANAVGLAMATKNLAANFNRPGYDVISNHTWCMIGDAC
LQEGVGLEAISFAGHLKLNNLTVIYDNNQITCDGSVDLTNTEDINAKMRACGWDVIDVED
GCYDVEGIVQALEKARASQEKPTFINVRTVIGLGSKVEGMAAAHGAAFGAPDVADMKRKY
GFNPDEHFVISDTVRGFFQELPTRGEALVQQWNSLVKQYSAEYPELGAEFQRRMRGELPS
NWKDLIPSSFPDKPTATRASSGLVFNPLAKDIESFMVGTADLSPSVNMIWPGKVDFQHPD
LRTTCKINGNYSGRYIHFGVREHAMCAISNGLAAFAPNTFIPITSSFFMFYLYAAPAVRM
GALQHLQVIHAATHDSIGMGEDGPTHQPIELAALYRAMPNLLYIRPGDSEETAGAWIAAL
EAKKSSSIISTSRHALPQLKQTRREGVALGAYVLEEADDASVTLIGVGAELSFALEVAQQ
LKETKGIAARVISFPCQRLFEQQPLEYKRTVLRRHQGIPAVVIEPYAPNGWERYGDAGIN
IRRFGHSLPGKAAYKFFGYETGVMAAKVSDYLDRLEKGEWQRGEFVDL
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggctgttggtcctgtcccgcaaagtaacggcgcatccgccttgccgctggtgcgccag
ctgtctaaagaccatgaccatgtcttgaaatcattccgtcttctcatttccgacctgtgt
cagcagttcggtggaggccacccgggtggagcaattggcatggcggccataggagtcgcc
ctctggcgatatgttatgcaatacgcgccacactcccccgactacttcaaccgcgatcgc
ttcatcctgtccaacggtcatacctgtctcttccagtacgcctttttgcatctcaccggc
tacaaagccatgacttttgagcagctaaagtcctatcactccgaccgcgtcgatgcatta
tgtccggggcacccggaaatcgaacacgagggcattgaagtcaccacaggccccttaggt
cagggcgttgccaatgctgtgggtcttgctatggccacgaagaatcttgcggccaacttt
aaccgtcctggatacgatgtcatatcgaaccacacctggtgcatgataggagatgcgtgt
ctgcaggaaggcgtcggactcgaggcaatctcctttgcgggtcatctcaaactcaacaac
ctgaccgttatctacgacaataaccaaataacctgcgatggctcagtcgacctgaccaac
acagaggacattaacgctaagatgcgtgcctgtggctgggacgtcattgatgtggaagat
ggttgctatgatgtcgaggggattgttcaagctttggagaaggcccgcgcatcccaagag
aagcctacctttatcaatgtccggaccgtcatcggtttaggcagtaaggtggaaggcatg
gctgctgcccatggtgccgcatttggtgctccagacgtagcagatatgaagaggaagtat
ggcttcaaccctgatgagcactttgtcatcagtgacacagtccgaggatttttccaggag
ctgcctactcggggagaagctcttgttcagcagtggaactctttagtgaagcaatatagc
gcagaatatcctgagcttggggcggagttccagagacgcatgcgcggagagctgccttcg
aactggaaggaccttatcccttccagcttccctgacaagcccacggctacgagagcttcg
tctggtctggtcttcaaccctctggccaaagatattgaatccttcatggtcggaactgct
gatctgagtccgtccgtgaacatgatctggccgggcaaagttgatttccagcaccctgat
ctacgaaccacttgcaagatcaacggcaactactctggccgatatatccacttcggagtg
cgtgagcatgccatgtgtgccatctcgaacgggttggcagcgtttgctccaaatacattc
atccctatcacctcatccttcttcatgttctacctttatgctgcccctgccgtgcgcatg
ggtgctcttcagcaccttcaggtcatccacgctgccactcacgactcaattggcatggga
gaagacggtccgacacaccaaccgatagagctggcagcgctctaccgtgctatgccgaat
ctgttgtatattcgaccgggagacagtgaggagacagcaggagcctggattgcagccctg
gaggccaagaagtcgtccagcattatctctacctcccgtcacgctctgccccagttgaag
cagactcgccgggagggagtggctcttggcgcgtacgtgctggaagaggctgatgatgcc
tcagtgacactcattggtgtcggcgcagagctctcatttgcgcttgaagtagcccagcag
ctgaaagagactaaaggaattgcggcacgcgtcatcagtttcccttgccagcgactgttc
gagcagcagcccctcgaatacaagcgcacggtcctgcgacgccaccaaggtatcccggct
gtggtgatcgagccatatgcgccgaacggctgggagcggtatggcgatgcaggcatcaac
atccgccgattcggccacagtttgccgggcaaggctgcatacaagttcttcggctacgag
accggagtaatggcggccaaggtgagcgattacctggaccggctagagaagggagaatgg
cagcgaggagaatttgtggatctatag

DBGET integrated database retrieval system