KEGG   Aspergillus niger: ANI_1_530084
Entry
ANI_1_530084      CDS       T01030                                 

Gene name
An09g04250
Definition
(RefSeq) indoleamine 2,3-dioxygenase subfamily
  KO
K00463  indoleamine 2,3-dioxygenase [EC:1.13.11.52]
Organism
ang  Aspergillus niger
Pathway
ang00380  Tryptophan metabolism
ang01100  Metabolic pathways
ang01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    ANI_1_530084 (An09g04250)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.52  indoleamine 2,3-dioxygenase
     ANI_1_530084 (An09g04250)
SSDB
Motif
Pfam: IDO DUF1864
Other DBs
NCBI-GeneID: 4983960
NCBI-ProteinID: XP_001393740
UniProt: A2QU38
AA seq 488 aa
MLPPIPALADYGISADHGFLPPEPPLEILPDPYYAKWEWIVSNLQALLTSRRIREVVDHM
SKLSTSYLQSENEWRRAYVVLVFMLHGYVWGGSKPAEKIPPQLTVPLFDVCEHLGLPPVA
TYAGVCLWNYKPIFPEESIDDLRNLDTINTFTGSLDEKWFYLVSVAIEARGAPSIPLVLQ
AIAAARAGNSLVVTECLQRLAEVLDEVGSLLERMYEHCDPYVFYHRIRPYLAGSKNMADA
GLPHGLLYDYGNGQPEYRQYGGGSNAQSSLIQFFDIALGIEHRPTGETRPSSTPMKDEKE
GVVGAPRHGFIQEMRTYMPAAHRRFLEHVNAVANIRQYVEARRSDKALCIAYDACLSMLR
AMRDKHIQIVSRYIIIQSRDARPSRPARATSPKRAINLATARHGEKPDSKKLRGTGGTAL
IPFLKQARDETGEPAIDAWARRLLSTGPSESSFAALSKVDEDHDGHLQVVGLSGTWAADD
SEGGICHW
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgcttcctccgattccagcattggcggactacgggatctcggcagaccatggcttcctc
cctccagagccaccccttgagatcttgccagacccctattatgccaagtgggagtggatc
gtttccaacctgcaggcactcttgactagccggaggatccgggaggtggtcgatcatatg
tccaagctgtctacatcatatcttcagtcggagaacgagtggcgcagggcctacgtcgta
ctggtatttatgctgcatgggtatgtatgggggggaagcaagccggcagagaaaatcccg
cctcagctgaccgtcccactattcgacgtctgcgagcacctgggtctgccgcccgtggcc
acttatgcaggggtgtgtctgtggaactataagcctatttttccggaggaatcgatcgat
gatctacgtaatctcgacaccatcaacacatttacagggtcattggatgagaagtggttt
tacctggtctccgtggccattgaagctcgtggagcaccctcgatcccgctggtgctgcaa
gcaattgcggcggcccgggctggaaacagcctggtagtcaccgaatgtctgcagcgactt
gctgaggtgctggacgaggtagggtcgctgctggagcgcatgtacgagcactgcgatccg
tatgtgttctaccaccgcatccgaccctatctggctgggagcaagaacatggctgatgct
ggcctcccgcatggtctattatatgactatggaaacggacagcccgagtatcggcagtat
ggcggcggtagcaatgcccagagctcactgatccagttcttcgacatcgcactgggcatc
gagcaccgtccgaccggggagacgcgtcctagcagcaccccgatgaaggacgagaaagag
ggtgttgttggggcacctcgtcacgggttcatccaggagatgcgtacatacatgcctgcg
gcgcaccgtcgtttcttggagcatgttaatgccgtggccaacatccgacagtatgtggaa
gcacgacgctcggacaaggcactgtgcattgcatacgacgcatgtctgtcgatgcttcgg
gcaatgcgcgacaagcacatccaaattgtatcccgctatatcatcattcagtctcgggat
gctcgaccgagtcgcccagcgcgcgcaaccagtcccaagagagccattaacttggcgacc
gcccgacacggtgagaagccggacagtaagaaattgcggggcacgggtggaacggccttg
atcccgttcctgaaacaagcacgggacgagacgggcgagccagcgatcgatgcatgggcc
cgtcggcttttgagcacaggaccgtcggagtctagcttcgcggcgctgagcaaagtggac
gaggaccacgatggacatctccaggtggtgggactatcaggaacatgggcagcggatgac
agcgagggtggcatatgtcattggtag

DBGET integrated database retrieval system