KEGG   Aspergillus niger: ANI_1_56074Help
Entry
ANI_1_56074       CDS       T01030                                 

Gene name
An08g00510
Definition
(RefSeq) methionyl-tRNA synthetase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ang  Aspergillus niger
Pathway
ang00450  Selenocompound metabolism
ang00970  Aminoacyl-tRNA biosynthesis
ang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ANI_1_56074 (An08g00510)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ANI_1_56074 (An08g00510)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ang01007]
    ANI_1_56074 (An08g00510)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ang03016]
    ANI_1_56074 (An08g00510)
Enzymes [BR:ang01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ANI_1_56074 (An08g00510)
Amino acid related enzymes [BR:ang01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ANI_1_56074 (An08g00510)
Transfer RNA biogenesis [BR:ang03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ANI_1_56074 (An08g00510)
 Prokaryotic type
   Other AARSs
    ANI_1_56074 (An08g00510)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-GeneID: 4982365
NCBI-ProteinID: XP_001392169
UniProt: A2QPX3
AA seq 659 aa AA seqDB search
MASDSKILPKKGQRNILVTSALPYVNNVPHLGNIVGSVLSADVFARFHKACGHQTLYICG
TDEYGTATETKALEEKVTPEELCAKYNKIHQQVYEWFEIGFDHFGRTPTQQHTEISQAIF
KKLYENGYLTEKTAEQPFCETHGSFLADRYVEGECPRCHYDDARGDQCDKCGHLLDPFDL
INPRCKLDGATPVRRSTKHIHLLLDKLQPQIEEWSKNAIEKGDWPKNSRVITESWLKEGL
KDRGITRDLKWGVPVPLEGFETKVLYVWFEACIGYPSITANYTSDWELWWRNPEDVQLYQ
FLGKDNVPFHSVIFPGSQLGTKEKWTMLHHLSTTEYLNYEGGKFSKSRGIGVFGTSAKET
GVPPDVWRYYLLKNRPETGDTQFEWRSFVESNNSELLAKLGNLVNRVIKLVTASYGSVVP
EFTVPESFQPTLDEVTATLRQYIEEMEGAHLRAGVVSAMKLAEAGNGLIQANRLDNSLIA
NEPERAAAVVGTVLNLIHLLASVFSPYLPATSKSINEQLDVPFGLIPSLEDIKDGWKPTA
IKPGHKIGKAKYLFSRIDPKKADEWREMFGGSQADRQKKEEEAAKAAAKKAAKDAAKAKK
KEKKAKAAEAAAAGADAGSNVEASAKGGAQAVEVTTDSKNDEAVEKVADGVAQVTIPSS
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagactccaagatcttgcccaagaagggccagcgcaatatcctggtcaccagt
gctttgccctacgttaacaatgtgcctcacttgggtaacattgttggttccgttctcagt
gctgatgtcttcgccagattccacaaggcttgcggacatcaaacactgtacatctgtggt
accgatgaatatggaacggcaacggagaccaaggctttggaggagaaggtgaccccggag
gagctgtgcgccaagtacaacaagatccaccagcaggtgtacgaatggtttgaaattggc
ttcgatcacttcggacgcaccccgacccagcaacacaccgagatttcccaggccatcttc
aagaagctgtatgagaacggctatctgacggagaagacggcggagcagccgttctgtgag
acacatggctctttcttggcggatcgttacgtggaaggtgaatgccctcggtgtcactac
gacgatgctcgtggagaccagtgcgataagtgcggtcacctcttggatcccttcgacctt
atcaacccccgctgcaagcttgatggcgccacccccgtccgccgctcgacgaaacacatc
caccttctcctcgacaagctccagcctcagatcgaagaatggtctaagaatgccatcgaa
aagggcgactggcctaagaactcgcgtgtcattaccgagtcttggttgaaggaaggtctg
aaggaccgcggtatcaccagagacctgaagtggggtgtcccggtgcctctggagggcttc
gagaccaaggtgctttatgtctggtttgaggcttgcattggttacccctccatcacggcc
aactatacctcggactgggagctctggtggcggaacccggaggatgttcagctgtatcag
ttcctgggcaaggataacgttcccttccacagtgttatcttccctggttctcagctagga
accaaggagaagtggactatgcttcaccacctgagcaccacggaatacttgaattacgaa
ggtggcaagttcagcaagtctagaggcattggtgtctttggtaccagcgccaaggagacg
ggtgtgcccccggatgtgtggcgctactacctcctgaagaaccgtcccgagactggtgat
acccagttcgaatggcgctccttcgttgagagcaacaacagcgagctgctggctaagctg
ggcaaccttgtcaaccgtgtcatcaagcttgttacggcatcctacggctcggtcgttccc
gagttcactgtccccgagagtttccagcctaccttggatgaagtcacggctactctcaga
cagtacattgaagagatggagggtgcacacctccgcgctggtgtggtgagtgcgatgaag
ctggccgaagccggcaacggactgatccaggccaaccgccttgataactcgttgattgcc
aacgagcccgagcgtgctgccgcggttgtcggtactgtgctcaacctgattcatctcctg
gccagtgttttctctccctacctccccgccacctccaagtcgatcaacgagcagctcgac
gtgccgttcggcctgatcccctctctggaggacatcaaggacggctggaagccgactgcc
atcaagccgggtcacaagatcggcaaggccaagtacctcttctctcgtatcgaccccaag
aaggccgacgagtggcgcgagatgttcggtggttcccaggccgaccgccagaagaaggaa
gaggaggcggctaaggcagcggccaagaaggcagcaaaggatgccgctaaggccaagaag
aaggagaagaaggccaaggctgctgaggccgctgccgctggtgctgatgctggcagcaat
gttgaagcctccgccaagggaggcgcccaggctgtggaggtcaccaccgatagcaagaac
gacgaggccgttgagaaggtcgccgatggcgtggcccaggtcaccattccctcctcctaa

DBGET integrated database retrieval system