KEGG   Aspergillus niger: ANI_1_610074Help
Entry
ANI_1_610074      CDS       T01030                                 

Gene name
An08g04240
Definition
(RefSeq) NADH-ubiquinone oxidoreductase C3A11.07
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
ang  Aspergillus niger
Brite
KEGG Orthology (KO) [BR:ang00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ANI_1_610074 (An08g04240)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     ANI_1_610074 (An08g04240)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 4982740
NCBI-ProteinID: XP_001392541
AA seq 578 aa AA seqDB search
MVGSTLAIRSKMASPSAAMQLSSLSRRSLSTRPQLLRSARPLRQQQFQRSTRRSYADAAP
AAPTPKPKKRFRFLRWTWRLTWLSTIGAAGALAYSVYELRHPVEQIKPDPTKKTLVILGT
GWGTVSLLKKLDTENYNVVVISPRNYFLFTPLLPSCTTGLIEHRSIMEPIRNILRQKTAH
VNFYEAEATKIDYEKRVVYISDDSEIKGDISHTEVPFDMLVVGVGAENATFGIPGVRENS
CFLKEVDDAQKIRKRIMDCIETAMFKDQTEDEVKRLLHMVVVGGGPTGVEFAGELQDFFE
DDLKKWVPEIQENFKVTLVEALPNVLPMFSKQLIDYTESTFKEEKISIRAKTMVKNVTDK
YIEAMVTNPDGSKSIERIPYGLLVWATGNAVRPVVRDLMNQLPAQKDSRRGLAVNEYLVV
NGAENVWAVGDCAITNYAPTAQVASQEGAFLARLFNTMAKTEAIEKELKQLSEAQAQAKG
EERDQVFDAIRERQKQLRRTKQIGPFQYSHQGSMAYIGKERAVADISWLSGNIASGGTMT
YLFWRSAYLSMCFSTRNRVLVAVDWIKAKLFGRDVSRE
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggttggaagtacgctggcgatccgctccaagatggcctctccctccgccgccatgcag
ttgtcgtcgctgtcgcgcaggtcgctttcgacgcgaccccagctccttcgctccgcacgt
cccttgagacagcagcaattccagcgctctactcgtcgctcctacgccgatgctgcgccc
gctgccccgacccccaagcccaagaagcgcttcaggttcttgcgctggacctggcgcctg
acctggctctccactatcggtgcggctggtgctctggcctacagtgtctatgaattgcgc
catcccgtcgagcagatcaagcctgatccgacgaagaagacccttgttatcctgggtacc
ggatggggtactgtttccctgctgaagaagctcgacactgagaattacaatgttgtcgtc
atctctcctcgcaactacttccttttcactcccctcctcccctcctgcacgactggtttg
atcgagcaccgctccatcatggagccgatccgtaacatcctccgtcagaagaccgcccac
gtgaacttctacgaagccgaagccaccaagatcgactacgaaaagcgtgtcgtgtacatc
agcgatgactctgagatcaagggagacatctcccacaccgaggtgcccttcgacatgctt
gtcgttggtgtcggtgctgaaaacgcaaccttcggtatccccggtgtccgggagaactcc
tgcttcctgaaggaggtcgacgatgctcagaagatccgcaagcgcatcatggactgcatt
gagactgccatgttcaaggaccagactgaagacgaagtcaagcgtcttctccacatggtt
gttgttggcggtggcccgactggtgtcgagttcgccggtgagctgcaggacttcttcgag
gacgacttgaagaagtgggttcctgagatccaggagaacttcaaggttaccctcgttgaa
gctcttcccaacgtccttcccatgttctccaagcagcttatcgactacaccgaatcgact
ttcaaggaggagaagatctctatccgcgcaaagactatggtcaagaacgtcaccgacaag
tacatcgaggctatggttaccaaccctgatggatccaagtccatcgaacgtattccctac
ggtctgctggtctgggctaccggtaacgctgttcgccccgtggttcgcgatctgatgaac
cagctccctgcccagaaggactcgcgtcgtggtcttgctgtgaacgagtacctcgtcgtg
aacggcgctgagaacgtctgggctgttggtgattgtgctatcaccaactacgcccctact
gctcaggttgccagtcaggagggtgctttccttgcccgtcttttcaacaccatggccaag
accgaggctatcgagaaggagttgaagcagctgtctgaggcccaggcccaggctaagggt
gaggagcgtgaccaggtctttgacgcaatccgcgaacgccagaagcagctgcggagaacc
aagcagattggtcccttccagtactcccaccagggtagcatggcctacatcggaaaggag
cgcgctgttgcggacatcagctggctgagcggcaacatcgccagtggtggtaccatgacc
tacctcttctggcgcagtgcttacctgagcatgtgcttcagcactcgcaaccgtgtcctg
gtcgccgttgactggatcaaggccaagctgtttggccgcgacgtctctcgggagtaa

DBGET integrated database retrieval system