KEGG   Aspergillus niger: ANI_1_642134Help
Entry
ANI_1_642134      CDS       T01030                                 

Gene name
An15g04660
Definition
(RefSeq) dehydrogenase
Organism
ang  Aspergillus niger
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 3HCDH_N F420_oxidored
Motif
Other DBs
NCBI-GeneID: 4988067
NCBI-ProteinID: XP_001397001
AA seq 360 aa AA seqDB search
MGEAPPVKEHLLIAYGRDLPQWLIDETQAKFPEAELSILQLPNFAPIPAEIARKTTLLVT
FSNLPAPEDASKIKIIHSLSSGLDHLLSHPIVKETSIPLTSSSGIHGPPIAEWTIMNWLV
ASRRFVYTHENQQKHNWAKNVDFMNTVHDQVGRKVGILGYGSIGRQIGRVASALGMQVHA
YTASPRPTPSSKKDNGYIVPGTGDRDGTIPVSWHHGTDKASIHEFLSLGLDHLVIALPLT
PQTTRMLGTEEFEILSRGVSAERPRPYLTNISRGKVLNQDALIEALKGGVLGGAALDVAD
PEPLPEDSPLWEVPNVQISPHVSSAGREYIPRSLDIMRENVGRLERGEELLNGFKRGKGY
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaagcacctcccgtcaaagagcatctgctcatcgcctacggccgcgatcttccg
caatggctgatcgacgagacgcaggccaaattccccgaagccgaactttccatcctgcag
ctgcccaatttcgcgccaattccagctgaaatcgcgcgcaagaccactctcctcgtcacc
ttcagcaacctccccgcgccggaagatgcatccaaaatcaaaatcatccactccctctcc
tccggcctcgaccacctcctctcccaccccatcgtcaaagaaacctccatccctctcacc
tccagctcgggcatccacgggcccccaatcgccgaatggaccatcatgaactggctcgtc
gcctcgcgacgcttcgtctacacccacgaaaaccaacaaaaacacaactgggcgaaaaac
gtcgacttcatgaacaccgtccatgaccaagtcggcaggaaagtcggaattctcggatac
ggaagtatcggacgacaaattggccgcgtcgcctccgctctaggcatgcaagtgcatgcc
tacacagcctcgccgcgcccgaccccgtcctccaagaaagacaacggctacatcgtcccc
ggcaccggcgaccgcgacggcaccatccctgtatcctggcaccatgggactgacaaggcc
tctatccacgaattcctatccctgggtctagatcaccttgtgattgcgttgccgctgaca
ccgcagacaacccgtatgcttgggactgaggaattcgagatcctgagtcgtggtgtgtct
gcagaacggccacgtccgtaccttacgaatatctctcgggggaaggtcctcaatcaggat
gcattgattgaggcgctgaaaggaggagtgctgggcggagcggcgctggatgtggcggat
ccggaaccgttgccggaggatagcccgttgtgggaggtgccgaatgtgcagatcagtccg
catgtcagttcggcggggagggaatatattccgcggtcgttggatattatgagggagaat
gtggggaggttggagaggggggaggaattgttgaatgggtttaagagagggaaggggtat
tga

DBGET integrated database retrieval system