KEGG   Aspergillus niger: ANI_1_746114Help
Entry
ANI_1_746114      CDS       T01030                                 

Gene name
An13g02770
Definition
(RefSeq) D-mandelate dehydrogenase
Organism
ang  Aspergillus niger
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh
Motif
Other DBs
NCBI-GeneID: 4986726
NCBI-ProteinID: XP_001396412
UniProt: A2R1X3
AA seq 359 aa AA seqDB search
MTKPIILHLGDPIAYNHDLYNDPLSTRFTIIRDTSPTREAFIEALKTNKYGPFVAIFRPH
FSSGTTMSPWDADLVSLLPPSVKIFASAGAGYNDISVPSLTARGIYYTNGAGASDEAVAD
TTLYMILSVFRNFTASQIAARSGDTERFLECHRNLAGVSTNPRGKVLGLIGLGRIGSEVV
RKVRGGLGMEVVYYDAVRLSEERERELGVRWGGGIRGVLEGADCVSVHCPLTEGTRGLID
KEKIGWMRDGVRVVNVARGGVVVEEDLVQGLRSGKVAAAALDVHEFEPVVDGRLREMENV
TLTTHVGGGAVETRIGFERLAMENILRVVGDDGEVVGEPVTAVNGREVREVWERMGKGE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacccataatcctccacctcggcgaccccatcgcctacaaccacgacctctac
aacgaccccctctccacccgcttcaccatcatccgcgacacctccccaacccgcgaagcc
ttcatcgaggcgctgaaaaccaacaaatacggccccttcgtcgccatcttccgcccacac
ttctcctccggcacgaccatgtccccctgggacgccgacctggtctccctccttcctccc
agcgtcaaaatcttcgcctcagcgggagcaggctacaacgacatctccgtcccctcgctc
accgcgcgcggaatatactacaccaacggggcgggcgcctccgacgaagccgtcgccgac
acaacactatacatgatcctgagcgtgtttagaaacttcactgcatcgcagatcgcggcg
cggtcgggcgatacggagaggtttctagaatgtcatcggaatctggcgggcgtgtcgacg
aatccgagggggaaggttctgggattgattggactggggaggattgggagtgaggtggtg
aggaaggtgaggggtgggttagggatggaggttgtttattatgatgcggtacggttgagt
gaggagagggagagggagttgggggtgagatggggcggggggattaggggggtgttggag
ggggcggattgtgtgtcggtgcattgtccgttgactgaggggaccagggggttgatcgat
aaggagaagattgggtggatgagggatggggtgagggttgttaatgtggccagggggggt
gtggtggttgaggaggatttggtgcaggggttgaggagtgggaaggtggctgctgcggcg
ttggatgttcatgagtttgagcccgttgtggatggtagactgagggagatggagaatgtt
acgcttacgacgcatgttgggggtggggcggttgagacgaggattgggtttgagaggttg
gcgatggagaatattttgagggtagtcggggatgatggggaggttgtcggggagccggtc
acggctgttaatgggagggaggtgagggaggtgtgggagaggatgggcaagggggagtga

DBGET integrated database retrieval system