KEGG   Aspergillus niger: ANI_1_76134Help
Entry
ANI_1_76134       CDS       T01030                                 

Gene name
An15g00410
Definition
(RefSeq) formate dehydrogenase
  KO
K00122  formate dehydrogenase [EC:1.17.1.9]
Organism
ang  Aspergillus niger
Pathway
ang00630  Glyoxylate and dicarboxylate metabolism
ang00680  Methane metabolism
ang01100  Metabolic pathways
ang01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ANI_1_76134 (An15g00410)
  09102 Energy metabolism
   00680 Methane metabolism
    ANI_1_76134 (An15g00410)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.9  formate dehydrogenase
     ANI_1_76134 (An15g00410)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh Peptidase_S78_2
Motif
Other DBs
NCBI-GeneID: 4987640
NCBI-ProteinID: XP_001396580
AA seq 419 aa AA seqDB search
MVFMRSFSRQLRRPATSLLSTKGAFAPAASSPFRAAPLANSIAGARTLTASANLQGKILM
VLYDGGEHAKQQPGLLGTTENELGLRKWLEEQGHTLVTTSDKEGENSTFDKELVDAEVII
TTPFHPGYLTAERLAKAKNLKIAVTAGVGSDHVDLNAANKTNGGITVAEVTGCNVVSVAE
HVVMTILTLVRNFVPAHEQIRRGEWDVAAVAKNEFDLEGKVVGTVAVGRIGERVLRRLKP
FDCKELLYYDYQPLAPEVEKEIGCRRVDNLEEMLAQCDVVTINCPLHEKTRGLFNKELIS
KMKKGSWLVNTARGAIVVKEDVAEAVKSGHLRGYGGDVWFPQPAPADHPLRTVQGPWGGG
NAMVPHMSGTSIDAQIRYANGTKAILESYFSGRHDYRPEDLIVHGGDYVTKAYGQRNKA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggtatttatgcgctctttctcccgccaactccggcgacctgccacttctctcctctcc
accaagggagccttcgcgcctgcggccagcagcccattccgggctgctcctttggctaac
tcgatcgctggtgcacgtacgctaaccgcctccgcgaatctacagggcaagattcttatg
gtcctctatgacggcggtgagcacgccaagcagcagcccggtctactgggtaccactgag
aacgagctcggcttgaggaagtggctcgaggagcagggtcacaccctggtcaccacttcc
gacaaggagggcgagaactcgactttcgacaaggagctcgtcgacgctgaagtcatcatc
accactcccttccaccccggttacctcactgctgagcgtctggctaaggccaagaacctc
aagatcgccgtcactgctggtgtcggttccgaccacgtcgacctgaacgctgccaacaag
accaatggcggtatcaccgttgccgaggtcaccggctgcaatgtcgtctccgtcgctgag
cacgttgtcatgaccatcctgaccctggtccgcaacttcgttcccgcccacgagcagatc
cgccgcggcgagtgggacgttgctgctgtcgctaagaacgagttcgacctcgagggcaag
gtcgtcggtaccgttgccgttggccgtatcggtgagcgtgtcctccgccgtctcaagccc
ttcgactgcaaggagctcctctactacgactaccagccccttgcccctgaggttgagaag
gagatcggctgccgccgtgtcgacaacctcgaggagatgctcgcccagtgtgatgttgtc
accatcaactgccctctgcacgagaagacccgcggtctgttcaacaaggagctcatctcc
aagatgaagaagggctcttggctcgtcaacaccgctcgtggtgccatcgtcgtcaaggag
gatgtcgccgaggccgtcaagtctggccacctccgcggctacggtggtgatgtctggttc
cctcagcccgcccccgccgaccaccctctgcgtactgtccagggcccctggggcggcggc
aacgccatggttcctcacatgtccggtacctccatcgatgcccagatccgctacgccaac
ggtaccaaggccatcctcgagagctacttctccggccgccacgactaccgccccgaggac
ctcatcgtccacggcggtgactacgttaccaaggcctacggtcagcgcaacaaggcctaa

DBGET integrated database retrieval system