KEGG   Aspergillus niger: ANI_1_802024Help
Entry
ANI_1_802024      CDS       T01030                                 

Gene name
An02g05830
Definition
(RefSeq) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
ang  Aspergillus niger
Pathway
ang00051  Fructose and mannose metabolism
ang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ANI_1_802024 (An02g05830)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     ANI_1_802024 (An02g05830)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N UDPG_MGDP_dh_N UPF0052 ApbA F420_oxidored Pyr_redox_2 Methyltransf_11 Methyltransf_25 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 4979072
NCBI-ProteinID: XP_001399719
UniProt: A2QD49
AA seq 388 aa AA seqDB search
MGKKAIQFGGGNIGRGFVAEFLHKAGYEVVFVDVMDKMVEALQQNKSYKVTEVSEEGEHT
TTITNYRAINSKTHESDVIQEIATADVVTCAVGPNILKFIAPVIAKGIDARTESKPVAVI
ACENAIGATDTLHGFIKQHTSQDRVESLYDRAQFANSAIDRIVPQQAPNSGLDVRIEKFY
EWAVEKTPFGSVGHPDIPAIHWVDNLEPYIERKLFTVNTSHATTAYFGHFRGKKMIADAL
EDKEIRGLVHKVLEETASLIVAKHDISEEEQKEYVEKIVSRISNPYLEDNVDRVGRAPLR
KLSRKERFIGPASQLAERGMKYDSLMDAVEMALRFQNVPGDDESAELANILQEQPAEDAT
TNLTGLEKEHPLYPAVLDRVRKVQQGTK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaaggctatccagttcggcggtggtaacatcggccgtggcttcgtcgccgaa
ttcctccacaaggcgggctacgaagtggtcttcgtcgatgtcatggacaagatggtcgag
gctctgcagcagaacaagtcgtacaaggtgaccgaggtcagtgaggagggtgagcacaca
acgactatcaccaactaccgtgccatcaactccaagacccatgagagcgacgtcattcaa
gagattgcgacggctgatgtcgtgacctgtgccgtgggccccaacattctcaagttcatc
gcccctgtcattgccaagggtatcgatgctcgcacagagtctaagcctgtcgctgtcatt
gcctgtgagaatgccattggcgctaccgacaccctgcacggcttcatcaagcagcacacc
agccaggaccgcgtcgagtccctgtatgaccgcgcccagtttgccaactctgccattgac
cgcatcgtccctcagcaagcccccaacagtggcctcgacgtccgcattgagaagttctac
gaatgggctgtcgagaagactccctttggctctgtcggccacccagacattcctgccatc
cactgggttgacaacctggagccatacattgagcgcaaactgttcactgtcaacaccagc
catgctactactgcctactttggtcacttccggggcaagaagatgattgctgacgctctg
gaggacaaggagatccgtggacttgttcacaaggttctcgaggagactgcctcactcatc
gtggccaagcacgacatctcagaggaggagcagaaggagtacgtcgagaagatcgtcagc
cgcatctccaacccttatctggaggacaatgtcgatcgcgtgggtcgtgctcccctgcgc
aagctgtctcgcaaggagcgtttcattggaccggcttcacagctggccgagcgcggcatg
aagtatgactctttgatggatgctgtcgagatggctctgcgcttccagaacgtgcctggt
gacgatgagagtgcggagctcgccaacattctccaagaacagccggcggaagatgccacc
accaatctcaccggcctggaaaaggaacacccactgtatcctgccgtgctggaccgggtg
cgcaaggtgcagcaggggacgaagtaa

DBGET integrated database retrieval system