KEGG   Aspergillus niger: ANI_1_804074
Entry
ANI_1_804074      CDS       T01030                                 

Gene name
An08g05640
Definition
(RefSeq) nitrite reductase [NAD(P)H]
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
ang  Aspergillus niger
Pathway
ang00910  Nitrogen metabolism
ang01100  Metabolic pathways
Module
ang_M00531  Assimilatory nitrate reduction, nitrate => ammonia
ang_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    ANI_1_804074 (An08g05640)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     ANI_1_804074 (An08g05640)
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Fer2_BFD Rieske_2 Rieske NIR_SIR_ferr Rubredoxin_C
Other DBs
NCBI-GeneID: 4982880
NCBI-ProteinID: XP_001392681
UniProt: A2QRD5
AA seq 1097 aa
MPLLDGSGNGDAVVMDSVPSVPSPAVDSLPDPAIRRSASNRRQKIVVVGLGMVAISFIEK
LVKQDSERRKYDIVVIGEEPHIAYNRVGLSSFFEHRKIEDLYLNPREWYGSIKDRSFDYH
LNTRVTDIFPDRKTVKTSTDDVIPYDILILATGSDAVLPTRTPGHDAKGIFVYRTISDLE
KLIEFASKHKGETGVTVGGGLLGLEAAKAMTDLQDFGSVKLVDRNKWVLARQLDGDAGTL
VTRKIRELGLDVLHEKRVARINTDDDNNVTGIVFEDGEELSCSCICFAIGVRPRDELGQS
AGIQCAGRGGFVIDESLQTSIEHIYAIGECASWENQTFGIIAPGIEMADVLAYNLTNPDK
ERKSFKRPDLSTKLKLLGVDVASFGDFFADRDGPKFLPGQRPSMPSGDVAEDEPPVKALT
YKDPFGGVYKKYLFTMDGKYLLGGMMIGDTKDYLKLNQMVKSQKELDVPPSQFILGAQSG
GEENADDLDDSTQICACHNVTKGDLVSNIKNGTCKTVAEVKSCTKAGTGCGGCMPLVQSI
FNKTMLDMGQEVSNNLCAHIPHARADLYNIIAIKQLKTFEDVMRTVGKNPDSLGCELCKP
AIASILSSLFNRHIMDKDLHELQETNDRFLANIQRNGTFSVVPRVPGGEITADKLITIGQ
VAKKYNLYCKITGGQRIDLFGAKKQDLLDIWTELVDAGMESGHAYAKSLRTIKSCVGTTW
CRFGIGDSVGMAIRLEERYKSIRSPHKLKGAVSGCVRECAEAQNKDFGLISTDKGFNIFV
GGNGGAKPRHSEILAKDVPPEKVIPMIDRYLIFYIRTADKLQRTARWIENLPGGIEYLRE
VVVEDKLGIGAEMEQQMQDLVDSYFCEWTETVRNPKRRKYFQQFANTDDTVDTVEVIRER
DQERPTYWPSEPAKEDFKGHQWSTLSWQPIIKADYFSDGSPQMSSANVKRGDTQLAIFKV
KGKYYATQQMCPHKRAFVLSDGLIGDDDAGKYWVSCPYHKRNFELNGEQAGRCSNDESMN
IATFPIEERDDGWIYLKLPPVEELDSVLGTEKWKVRKGEAPDPFKKHDKKYKGMRGKKAG
EKASGCGTAAPSSVIDW
NT seq 3294 nt   +upstreamnt  +downstreamnt
atgcctctgttggatgggtctgggaacggtgacgctgtcgtcatggacagcgtccccagt
gttccctcgcccgcagttgattccctaccagacccggctattcgccgatcggcttcgaat
agacgccagaagatcgtggtggtcggcttgggcatggtggctatctccttcattgagaag
ctcgtcaagcaggactctgagcgacgaaagtatgatatcgttgtaattggcgaagagcca
cacatcgcctacaaccgagtcggcctctcatcgtttttcgaacatcgcaagatcgaggat
ctttacctgaacccgagagaatggtacggttccatcaaagaccgatcctttgactatcat
ctcaacactcgggtaaccgacatcttccccgaccgcaagacggtcaaaacctcgactgat
gatgttatcccctacgatatcctgatcctggctacgggctcggatgccgtgctgcccacg
cgcaccccaggacacgatgccaaaggcatctttgtttaccggacgatctcggatctggaa
aagctcatagagtttgcgtcaaagcataaaggtgagacgggcgttactgtaggaggtggt
ctgttgggtctagaagcagccaaagcgatgacagacctgcaagactttggtagtgtcaaa
ctcgtcgatcgcaacaagtgggtgttagcgagacagctcgatggagatgctggcaccctt
gtgacccgcaaaatccgagagctgggattggatgtgctacatgagaagcgggttgcacgc
ataaatacggatgatgacaacaatgttactggaattgtcttcgaggatggggaagagctc
agctgctcgtgcatctgttttgctatcggagtcaggccacgagatgagctgggccagtct
gcggggatccagtgtgctggaagaggaggtttcgttatcgatgaaagtctccaaacatcc
atcgaacacatttatgcgatcggcgaatgtgctagttgggagaaccaaacctttggtatc
atcgcccccggcatcgagatggccgatgtgctcgcatacaacctcaccaaccccgacaag
gaacgcaagagcttcaagcgaccagatctcagcaccaagctaaagctgctaggtgtagat
gtggccagctttggagatttcttcgccgatcgggatggacccaagttcctccccggtcag
cggccgtcaatgccctccggagatgtagctgaagatgagccgcctgtaaaggcccttact
tacaaggatccttttggcggtgtctacaagaaatatctctttacaatggacggcaaatat
ctcctgggtggcatgatgatcggagatacaaaggactacctcaagttgaatcagatggtc
aagtcccaaaaagagctggacgtacctcccagccagttcattctgggggctcagagcggc
ggagaggaaaacgccgacgatctggatgacagcactcaaatttgcgcctgccataatgtt
accaaaggcgacttggtttcaaacattaaaaatggcacctgcaaaaccgttgcggaggtc
aagtcgtgcactaaagcggggaccggctgtggcggctgtatgccgctagtgcaatcgatc
ttcaacaagaccatgctggacatgggacaagaagtctcgaacaacttatgtgctcatatt
ccacacgcgcgggccgatctctacaatatcattgccattaagcaactgaagacgttcgag
gatgtcatgaggacggtcggcaagaaccccgactcgcttggctgcgagctgtgtaagcct
gcaatcgcctcgatcctctccagtcttttcaacagacacatcatggataaggatttacat
gaattacaagaaacaaacgatcggttccttgccaacattcagcgcaatgggaccttctcg
gttgttcctcgagtgcctggaggggaaatcaccgcggacaaattgatcacgatcgggcaa
gtcgctaaaaaatacaacctttattgcaagattactggaggtcagcgtatcgatttgttt
ggggctaagaagcaggatctgcttgacatctggacggaattggtcgatgcgggtatggag
agcgggcatgcgtacgccaagtcacttcgcactatcaagagctgcgtggggaccacatgg
tgccggttcggtattggcgacagtgttggcatggccatccggctagaagagcgctacaag
agtatccgctccccgcacaagttaaagggcgctgtttccggctgcgtgcgcgaatgcgca
gaggcacagaacaaagatttcggtctcatttccaccgacaaaggcttcaacatcttcgtt
ggaggcaacggaggtgccaaacctcggcattccgagatcctcgccaaagatgttccgccc
gagaaggtcatcccgatgatcgatcggtatcttatattctacatccgcacagcagacaag
ctgcaacggacagctcgctggattgaaaacctcccgggtggtattgaatatctacgtgag
gtagtcgtggaagataaattgggcattggggcggagatggaacagcagatgcaggatctg
gttgacagttatttctgcgagtggaccgaaacagtgcgaaaccccaagcggcgcaaatac
ttccaacaatttgccaacacggacgacacggtcgacaccgtggaggtgatcagggagcgc
gatcaggagcgcccgacctactggcctagcgaaccggccaaggaagacttcaagggtcac
caatggtccactctctcgtggcagccgatcatcaaggctgactacttctcggatggctcg
ccacagatgtcatccgccaatgtgaagcgcggggacacgcagctggctatcttcaaggtc
aagggcaagtactacgcgacgcagcagatgtgccctcacaaacgggcgtttgtcctgtca
gacgggttgattggcgacgacgacgccggcaagtattgggtgtcatgcccctaccacaag
cgcaatttcgagctcaacggggagcaggcaggccgatgctcgaatgacgagagcatgaac
atcgcaacgtttccgattgaggaacgggatgacgggtggatctacctgaagctgccgcct
gtcgaggagctcgactcggttctgggaacggagaagtggaaggtgcgaaagggcgaggcg
cccgatcctttcaagaagcatgacaagaagtacaaggggatgcgagggaagaaggcgggc
gagaaggcatccgggtgcggtacggctgcgccgtcctccgtgattgactggtag

DBGET integrated database retrieval system