KEGG   Aspergillus niger: ANI_1_820034Help
Entry
ANI_1_820034      CDS       T01030                                 

Gene name
An03g06550
Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
ang  Aspergillus niger
Pathway
ang00500  Starch and sucrose metabolism
ang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ANI_1_820034 (An03g06550)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     ANI_1_820034 (An03g06550)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20 DUF5397
Motif
Other DBs
NCBI-GeneID: 4980642
NCBI-ProteinID: XP_001390530
UniProt: A2QHE1
Structure
PDB: 

AA seq 640 aa AA seqDB search
MSFRSLLALSGLVCTGLANVISKRATLDSWLSNEATVARTAILNNIGADGAWVSGADSGI
VVASPSTDNPDYFYTWTRDSGLVLKTLVDLFRNGDTSLLSTIENYISAQAIVQGISNPSG
DLSSGAGLGEPKFNVDETAYTGSWGRPQRDGPALRATAMIGFGQWLLDNGYTSTATDIVW
PLVRNDLSYVAQYWNQTGYDLWEEVNGSSFFTIAVQHRALVEGSAFATAVGSSCSWCDSQ
APEILCYLQSFWTGSFILANFDSSRSGKDANTLLGSIHTFDPEAACDDSTFQPCSPRALA
NHKEVVDSFRSIYTLNDGLSDSEAVAVGRYPEDTYYNGNPWFLCTLAAAEQLYDALYQWD
KQGSLEVTDVSLDFFKALYSDAATGTYSSSSSTYSSIVDAVKTFADGFVSIVETHAASNG
SMSEQYDKSDGEQLSARDLTWSYAALLTANNRRNSVVPASWGETSASSVPGTCAATSAIG
TYSSVTVTSWPSIVATGGTTTTATPTGSGSVTSTSKTTATASKTSTSTSSTSCTTPTAVA
VTFDLTATTTYGENIYLVGSISQLGDWETSDGIALSADKYTSSDPLWYVTVTLPAGESFE
YKFIRIESDDSVEWESDPNREYTVPQACGTSTATVTDTWR
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttccgatctctactcgccctgagcggcctcgtctgcacagggttggcaaatgtg
atttccaagcgcgcgaccttggattcatggttgagcaacgaagcgaccgtggctcgtact
gccatcctgaataacatcggggcggacggtgcttgggtgtcgggcgcggactctggcatt
gtcgttgctagtcccagcacggataacccggactacttctacacctggactcgcgactct
ggtctcgtcctcaagaccctcgtcgatctcttccgaaatggagataccagtctcctctcc
accattgagaactacatctccgcccaggcaattgtccagggtatcagtaacccctctggt
gatctgtccagcggcgctggtctcggtgaacccaagttcaatgtcgatgagactgcctac
actggttcttggggacggccgcagcgagatggtccggctctgagagcaactgctatgatc
ggcttcgggcagtggctgcttgacaatggctacaccagcaccgcaacggacattgtttgg
cccctcgttaggaacgacctgtcgtatgtggctcaatactggaaccagacaggatatgat
ctctgggaagaagtcaatggctcgtctttctttacgattgctgtgcaacaccgcgccctt
gtcgaaggtagtgccttcgcgacggccgtcggctcgtcctgctcctggtgtgattctcag
gcacccgaaattctctgctacctgcagtccttctggaccggcagcttcattctggccaac
ttcgatagcagccgttccggcaaggacgcaaacaccctcctgggaagcatccacaccttt
gatcctgaggccgcatgcgacgactccaccttccagccctgctccccgcgcgcgctcgcc
aaccacaaggaggttgtagactctttccgctcaatctataccctcaacgatggtctcagt
gacagcgaggctgttgcggtgggtcggtaccctgaggacacgtactacaacggcaacccg
tggttcctgtgcaccttggctgccgcagagcagttgtacgatgctctataccagtgggac
aagcaggggtcgttggaggtcacagatgtgtcgctggacttcttcaaggcactgtacagc
gatgctgctactggcacctactcttcgtccagttcgacttatagtagcattgtagatgcc
gtgaagactttcgccgatggcttcgtctctattgtggaaactcacgccgcaagcaacggc
tccatgtccgagcaatacgacaagtctgatggcgagcagctttccgctcgcgacctgacc
tggtcttatgctgctctgctgaccgccaacaaccgtcgtaactccgtcgtgcctgcttct
tggggcgagacctctgccagcagcgtgcccggcacctgtgcggccacatctgccattggt
acctacagcagtgtgactgtcacctcgtggccgagtatcgtggctactggcggcaccact
acgacggctacccccactggatccggcagcgtgacctcgaccagcaagaccaccgcgact
gctagcaagaccagcaccagtacgtcatcaacctcctgtaccactcccaccgccgtggct
gtgactttcgatctgacagctaccaccacctacggcgagaacatctacctggtcggatcg
atctctcagctgggtgactgggaaaccagcgacggcatagctctgagtgctgacaagtac
acttccagcgacccgctctggtatgtcactgtgactctgccggctggtgagtcgtttgag
tacaagtttatccgcattgagagcgatgactccgtggagtgggagagtgatcccaaccga
gaatacaccgttcctcaggcgtgcggaacgtcgaccgcgacggtgactgacacctggcgg
tag

DBGET integrated database retrieval system