KEGG   Aspergillus niger: ANI_1_998024Help
Entry
ANI_1_998024      CDS       T01030                                 

Gene name
An02g07250
Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ang  Aspergillus niger
Pathway
ang00220  Arginine biosynthesis
ang00330  Arginine and proline metabolism
ang01100  Metabolic pathways
ang01110  Biosynthesis of secondary metabolites
ang01130  Biosynthesis of antibiotics
ang01230  Biosynthesis of amino acids
Module
ang_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    ANI_1_998024 (An02g07250)
   00330 Arginine and proline metabolism
    ANI_1_998024 (An02g07250)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     ANI_1_998024 (An02g07250)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 4979214
NCBI-ProteinID: XP_001399859
UniProt: A2QDI8
AA seq 324 aa AA seqDB search
MTSPSTIRQRFLSKPNQLGVVAVGFNGGQCKMGVEAAPMALVQAGLLEQLRDDLGYELHY
DEKVHHYEDKMPESDPDHRGMKKPRSVSAVTESLSAQVYEHAKEGKFVLTLGGDHSIAIG
TISGTAKAIRERLGREMAVIWVDAHADINVPEMSPSGNIHGMPMAFLTRLAREEQKDIFG
WLQDEHIINTRKLVYIGLRDVDRGEKQLLREHGIKAFSMHDVDRYGIGRVVEMALAHIGN
DTPIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDFICECVHETGNLVAMDLVEVNPSLE
EHGASDTIRTGCSIVRSALGDTLL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacttctccttcgacaattcggcagagattcctctccaagcccaaccagctgggcgtc
gtggccgttggtttcaatggcgggcagtgcaagatgggcgtcgaagcagccccgatggct
ctcgttcaagccggtctgctcgagcaactgcgcgacgatctgggctacgaactgcactat
gacgaaaaggtccaccactacgaagacaagatgcccgagtccgaccccgaccaccgcggc
atgaagaagccccggtcggtcagcgccgttaccgagtcactgagcgcccaggtctacgag
cacgccaaggagggcaagttcgtgctgaccctgggtggtgaccactccatcgctatcggt
accatctccggcacggccaaggctattcgtgagcgactgggccgtgaaatggctgttatc
tgggtggatgcgcacgctgatatcaacgtccctgagatgagccctagtggtaacatccac
ggtatgcccatggcgttcttgacgcgcttggctcgtgaggaacaaaaggatatcttcggc
tggctgcaggatgagcatattatcaacacccgcaagctggtatacatcggtcttcgggat
gtggatcgcggtgagaagcagttgcttcgtgagcatggcattaaggcgtttagcatgcat
gatgttgatcggtacggcattggccgcgtggtcgaaatggccctggcgcacattggcaat
gacacgccgatccacctgtcgttcgacgtcgacgcgctggacccgcagtgggcgcctagc
acgggtacccctgtgcgtggtggactgacgctgcgcgaaggtgacttcatctgcgagtgt
gtgcacgagacgggcaacctggtggcgatggatttggtggaggtgaaccccagcctggag
gagcatggagctagcgacactattcggacgggatgttcgattgtgcggagtgccttggga
gatactctgctgtag

DBGET integrated database retrieval system