KEGG   Aspergillus niger: ANI_1_1106014
Entry
ANI_1_1106014     CDS       T01030                                 

Gene name
An01g08310
Definition
(RefSeq) ubiquitination network signaling protein acrB
  KO
K24766  ubiquitination network signaling protein AcrB
Organism
ang  Aspergillus niger
Brite
KEGG Orthology (KO) [BR:ang00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    ANI_1_1106014 (An01g08310)
SSDB
Other DBs
NCBI-GeneID: 4977242
NCBI-ProteinID: XP_001389257
UniProt: A2Q9L8
AA seq 1017 aa
MPRSSATARKSHSNRHENGLVGPGKKVNKQKSNGNLNGNTNGASAPNSGPSTQVDWPASR
SSSDSALTSSATTASKVNGSADTSKADGNGRGLLNGYAKGNADMSYGQTNGAVPQNGGLA
GQASRRTEKPATGSKKSGSINPLQLASTILKSCPMYDTIAILIFLLQLPPMVLTLVQFLF
ASLTFMPPSGASSGSLTSNFDIFQGPAGTPSLGTMIAMDGFCLLFWGLFMWTWAQNFALD
LAHVQVAITLGGGGSGKNGGVNALCVGIVLVLHLIRSKGIQDFVIGHLLSAKIVSPDFLS
QYSHLMPPEFRRTEPQSSPSWMRSLLAVHILAQAGTAMARRSMAKNRSPAPPRNGKRVDT
EASAGSQTQIDSAFESGASVSSYIGADGQLVTPATHKDGRDRLMSAKKRRRQANQVRSRQ
PFWAALASTKVTVMREYEHSRALNKTGRGLMMTEEDLQGISLDDGLVWITEVDSSTIKFA
AGDFSSVDDPALAGVCETARLGNDETEPFYVCVNGALWATATITKVQDAPKGSNTVHWRG
EVSGLAPNCAYTCSFVRSDTDEEICVMSVKTPAATDAEQVSSIPTPPQPSYRPSSPTTTL
KNSIVNAEVKLNEKRARLRKAKNDHKLVISKIRKELDNYNHRLQSGTDENRQKQRSLQLE
RNIKQTEEITAALESQLDNLENIPEEELEEWSTQKSKYEQELEQLNLAKEELVSARAAVA
REVSSLESELNSAIQRKERLQGRRTRVNEQYERIVSANAQGLNERERRAAEQFAREQDQA
KLEANFHEQFASISQSVQEYQVRTNQLWQQAAAIEQAIQQQQQQMLLDSAPLTPEGNLPG
TNPLTEAPGMSLGALTTTAPNTRSLLGLSFPSLKSSPLQHASSPVGAASSHPTSPTQPPS
YLQHFPTSPLGNTGNYFDMDFTYRDRSFSNRSAHSSLYGADFLDSNRRGPFQLDLSDTVI
EKRMDSGSEGVTPNPIMRPISTPFQRADSRGSGSGSGSSGASGSGSGSPSSTGGKGN
NT seq 3054 nt   +upstreamnt  +downstreamnt
atgccacgttcatcggccacggctaggaagagtcatagcaatcggcatgagaatggtctc
gtcggccccggaaagaaagtgaacaagcaaaagtccaatggaaatttgaatgggaacacc
aacggcgcctctgccccgaattctggtccctccactcaagtcgactggcccgcatctcgc
tcttccagcgattcagccttaacctcatcggcaaccacggcaagcaaggtcaacggctcg
gcggacacctcgaaggcggatggcaacgggcgcggcttgctgaatgggtatgctaagggt
aacgcggacatgtcttatggccagacgaatggcgccgtgccccagaatggcggacttgcc
gggcaggcgtcgcggcgaacggagaagccggcgaccggttccaagaagtcgggctctatc
aatcccctccagctcgcatcgacgatccttaagtcctgcccgatgtacgacacgatcgcc
attctgatcttccttttgcagctgccgcctatggttctcactctggttcagttcctcttt
gcttccctgacgttcatgcctcctagcggtgcatcgtctggctccttgacctccaacttc
gacatctttcagggtcccgcaggaacgccttctcttggcacaatgatcgccatggatgga
ttctgcttactcttctggggccttttcatgtggacatgggcgcagaactttgcgctcgat
ctagctcacgttcaagttgccatcacgctaggtggaggagggtcgggaaagaatggaggg
gtcaatgccctctgcgttggcattgttctcgtattacatcttatccgcagtaaaggtata
caggattttgttataggtcatctgctctccgccaaaatcgtctcgcctgatttcttatcg
caatattcgcatctcatgccccccgagtttcgccgcacggaaccgcaaagctccccaagt
tggatgcgcagtctccttgccgttcacatcttggctcaagcaggcaccgctatggcaaga
agatcgatggcgaaaaaccggtcaccggctccccctcgcaacggcaagcgcgttgatacc
gaagcctctgccgggtcgcagacacaaattgattctgcgttcgagtccggggctagcgta
tcttcctacatcggtgccgacggtcaactcgttacgccagcaactcataaggatggcaga
gatagactcatgtcggcaaagaaacgcagaaggcaagccaatcaggtccggagccgtcaa
ccgttctgggctgcactcgcgagcacgaaggtgacggtgatgagggaatacgagcattct
agggccctcaacaaaaccggcagggggcttatgatgacagaggaggatcttcagggcatt
tcgttggatgatggacttgtttggataaccgaagtcgatagctctactatcaagtttgcc
gcgggtgacttttcctccgtcgatgatcccgcgcttgccggagtctgtgaaactgctcgt
ctgggaaatgacgaaacggaacctttctacgtctgtgttaacggcgccttgtgggcaacg
gcaacgattaccaaggtgcaggatgccccgaaggggtccaacacggtacactggcggggc
gaggtctcggggcttgctcctaactgtgcctacacttgctccttcgtgcggagcgatact
gatgaagagatctgtgtcatgagcgtcaagacacctgctgcaactgacgcggaacaagtc
tcttcgatcccaactcctccgcaaccgtcttatcgtccgtcatcaccaaccactacgctc
aagaactcgatcgttaacgccgaggtcaaactaaatgagaaacgcgcccggttaaggaaa
gccaaaaacgaccacaaacttgtcatctccaagatcaggaaggaactggataactacaac
catcgtctgcagagtggtaccgatgagaaccgacagaagcagcgctcgttacaacttgag
agaaacattaagcaaaccgaggaaatcaccgccgctcttgaaagccaactcgacaatttg
gagaacattcctgaggaagaactcgaagaatggtcgacccagaaatccaagtacgaacag
gagttggaacaactcaatttggctaaggaagagctcgtttctgctcgggccgctgttgct
cgcgaagtgtcgtcgttggagtcggagctgaactcggccatccagagaaaggaacgtctt
caaggccgccgtaccagggtcaatgagcaatacgagcggattgtctctgccaacgcccag
ggcttgaatgagcgagagcgtcgtgctgcggaacagttcgctcgggagcaggaccaggcg
aagttggaggccaatttccacgagcagtttgcgagcatcagccagtccgtacaggaatac
caggtgcgcaccaaccaattgtggcagcaagctgctgctattgagcaagccatccagcag
cagcaacagcagatgcttttggattctgccccgcttactcccgaaggtaacctgcctggc
acaaaccctctgactgaggcacctggcatgtctttgggagcattgacaacgactgcgccc
aacactcgatctctcctgggacttagcttcccgtcgctgaagtctagtccgctgcagcat
gcctcgtcccctgttggtgctgcttcgtctcatccgactagtccgacacagccaccgtct
tacttgcaacacttcccgacttctccgcttggtaataccggcaactacttcgatatggat
tttacctaccgtgaccggtctttttccaaccgatctgcgcacagcagtctctacggtgct
gatttcttggactctaatcgtcggggtcccttccaacttgacctgtccgatacggtcatt
gagaagcggatggattcgggctccgagggagtgactccaaacccgatcatgagacccatt
tccaccccttttcagcgggccgatagtcgtggtagcggaagtggaagcggaagtagcggt
gcaagcggtagtggaagtggcagtcccagctcgacgggtggtaagggcaactag

DBGET integrated database retrieval system