KEGG   Aspergillus niger: ANI_1_1278014
Entry
ANI_1_1278014     CDS       T01030                                 

Gene name
An01g09480
Definition
(RefSeq) hypothetical protein
  KO
K17103  CDP-diacylglycerol---serine O-phosphatidyltransferase [EC:2.7.8.8]
Organism
ang  Aspergillus niger
Pathway
ang00260  Glycine, serine and threonine metabolism
ang00564  Glycerophospholipid metabolism
ang01100  Metabolic pathways
ang01110  Biosynthesis of secondary metabolites
Module
ang_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ANI_1_1278014 (An01g09480)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANI_1_1278014 (An01g09480)
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.8  CDP-diacylglycerol---serine O-phosphatidyltransferase
     ANI_1_1278014 (An01g09480)
SSDB
Motif
Pfam: CDP-OH_P_transf
Other DBs
NCBI-GeneID: 4978033
NCBI-ProteinID: XP_001389368
AA seq 243 aa
MSRRVSAMPSNTSTTSGVPPAGDGGQEKQKMLLSSETGHFSMIRALHLADLVTELNGFCG
VMSVFSSMRYCLGDPRDFGAIWAALIFMPFGLFFDFMDGRIARWRKKSSLMGQELDSLAD
LISFGMAPAAAAFALGMRTSLDHLLLSFFVLCGLTRLARFNVTVAVLPKDKSGKSKYFEG
TPIPTTLSITFFLAYCVSQDWVLDDLPLGLVAQGTAFEFHPLVLLFVLHGCLMVSKTLHI
PKP
NT seq 732 nt   +upstreamnt  +downstreamnt
atgtctcgcagggtttctgccatgccgtcaaatacttccacgactagcggtgtcccacct
gcgggtgacggtggtcaagaaaagcaaaagatgcttctctcttccgaaacaggtcatttt
agcatgatcagggctctgcatcttgctgatctagtaactgaactcaatggattctgtgga
gtgatgtccgttttttcttcgatgcgttactgtcttggtgaccctcgtgattttggtgca
atttgggcggctctgatcttcatgcccttcgggctgtttttcgatttcatggatggacgg
attgctaggtggaggaaaaagtcgtcgctcatgggacaagagcttgattcactggccgat
ttgatttccttcggaatggcacccgctgccgcagcttttgcgctcggaatgcgcaccagc
ctcgaccatttgctcctctccttctttgttctgtgcggcctgacacgcttggcacggttc
aacgtgactgttgctgttctgccgaaagacaagtctggaaagtcgaagtacttcgagggc
acgcccatcccaacgaccttgtcaatcacctttttcctggcctactgcgtctctcaagac
tgggtgctggacgatctacccctcggccttgtagcccagggcacagcgttcgagttccac
ccgctggtactgttgtttgtcttgcacggatgcctcatggtcagcaaaacgctgcatatc
cctaagccttaa

DBGET integrated database retrieval system