KEGG   Aspergillus niger (black aspergilli): ANI_1_1318014
Entry
ANI_1_1318014     CDS       T01030                                 
Symbol
An01g09750
Name
(RefSeq) cytochrome B5
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ang  Aspergillus niger (black aspergilli)
Pathway
ang00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ANI_1_1318014 (An01g09750)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     ANI_1_1318014 (An01g09750)
SSDB
Motif
Pfam: FAD_binding_6 NAD_binding_1 Cyt-b5 NAD_binding_6 FAD_binding_9
Other DBs
NCBI-GeneID: 4978413
NCBI-ProteinID: XP_001389395
UniProt: A2QA06
AA seq 475 aa
MATFTLEQVQKHNTADDLWIVLHNKVYNITKYLEDHPGGKEILIEVAGTDATEAFEEIGH
SDEAREQLEPYFVGDLPSEEQTEAVEIYRPNYQQVSQSTVIKVKKTSPWGFLRTASKLGL
GGLVVTAIVTVYNRGMTPSQALQVVQHSALSFTQLPRGADLNNASHFWLGAGLASIVQFS
ATLGLGLWASTKLDVQQEFTHYASHRPSKPAHLMHLSKTATIPRPKPLDPRQWRPFTMTQ
KTEIAPNVYHIIFSLPNPDDILGLPTGQHIVLRATINGTSVARSYTPISNNNDRGRIELL
VKAYPQGAMTQHLAQMKIGDTIEIRGPKGAMQYTPRYAKHIGMIAGGTGITPMYQLIRAI
CEDPTDTDTCISLLYANNTEEDILLRAELEAFARNHPDRFQVHYVLSRPDDGWTGYRGFV
SVELIQKHLPVAGPDNKMLLCGPPPMVGAMKKVLLDLGWTMPGAVAKAGDQVFLF
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcgactttcacactggagcaggtgcagaagcacaacacggccgacgacctctggatc
gtcctccacaacaaagtctacaatattaccaagtacctagaagaccatcccggtggaaaa
gaaatcctcatcgaagttgccggtaccgatgccaccgaagcgtttgaagaaatcggccac
tcggacgaggcgcgcgagcagctcgagccctactttgttggcgacttgccttctgaggaa
caaaccgaggctgtggagatctaccgtccaaactaccaacaagtatcacagtccactgtc
atcaaggtgaagaagacctcgccatggggattccttcgcacggcaagcaagctcggattg
ggcggtctcgtcgtcacagccatcgtgacagtctataaccgaggcatgacaccctcacaa
gccctccaggttgtgcagcactcggcgctttccttcacccaactcccacggggtgccgat
ttgaataacgccagccacttctggttaggtgcaggcctcgccagcatcgtccaattctcc
gccacacttggcctaggcctatgggcgtcgacgaaactagacgttcagcaagagttcacg
cactatgcctcacatagaccatcgaagcccgcgcatctgatgcacctttctaagacagcc
accatcccgagaccgaaacctctcgacccgcgacaatggcgacccttcaccatgacccag
aagacagagatcgccccgaacgtataccacatcatattctccctaccaaaccctgacgac
atcctcggcctcccgacaggacaacacattgtcctacgtgcaacaatcaacggcaccagc
gtagcacgctcatacacccccatatcgaacaacaacgaccgcggccgcatcgagctcctc
gtaaaggcctacccgcagggcgcaatgacgcagcacctagcgcagatgaaaataggcgat
accatcgagatccgcggccccaagggcgccatgcagtacaccccacggtatgccaaacac
atcggtatgattgccggcggcaccggcatcacccctatgtaccagcttatccgcgccatt
tgcgaagatccgacagacactgatacatgcatctctcttttgtatgctaataataccgag
gaggatattttgcttcgcgcagagctggaggcttttgctcgtaatcatccggataggttc
caggtgcattatgtgctcagtaggcctgatgatggctggactgggtaccgagggtttgta
agtgttgagcttattcagaagcatttgcctgttgctggaccggataataaaatgctcctg
tgtgggccaccgccgatggtgggggctatgaagaaggtgttgttagacttgggatggact
atgcctggggcggtggcgaaggctggggatcaggtgtttttgttttga

DBGET integrated database retrieval system