KEGG   Aspergillus niger: ANI_1_2962014
Entry
ANI_1_2962014     CDS       T01030                                 

Gene name
An01g10060
Definition
(RefSeq) Zn(II)2Cys6 transcription factor
Organism
ang  Aspergillus niger
SSDB
Motif
Pfam: Fungal_trans Zn_clus
Other DBs
NCBI-GeneID: 4978221
NCBI-ProteinID: XP_001389425
UniProt: A2QA36
AA seq 1139 aa
MNTSPPSILPGYGQTNGTPRSQFRSSYDSPASGSSASAAPKTGKPGGRQITRNRASYSCH
TCRRRKVKCDKVHPICGNCVKNGTECVYDAAPQKDESRASISKNGHGVKRRRESSRPIEE
DIDDIQSIYGHLKQSGASEQRSQAIEARLDKLTSMIERLSKTNQPLDLAGKQRLAPNVKI
EQAESDPRLNNIAALKPAAGSRSDSPRRAAESSGDEFPIPAGHATDLVDPVGSLNLGHLS
LEDGGRSRYVGTTYWAYISHEINELNQLLRDQNRSHNEPSFNESPVDDAGTEPMAATPGR
QWKESADGVSEPAEKLSRGQTFQKSVLFPSSQSPSVTGKIVEPEMLENMPTKRQSHILYK
GFMSGIHAITPVVHPPTILKLYNSFWDWYDSSSYSGESCPDPSFIPLLYAIWYGGSVTVS
LRTIKAEFNVPSRSGLSKAYSEEVTRWLSKISFPRSPSMQGLSAYLLVQTILSKEEEPLT
SSLFISLAMRVAQTMGLHRDPAKFGIGPSDAEYRRRIWWHIVHMDGVVAMSSGLPPLVSD
ENYWDVRETSEVKDTLLGTPAAEKYERLVMTGMRPPDNPDDPTVCGGPSMVNVYYLSAKG
KYTMARAVRRIMKIQLGTKPVTRRDMEELRSILVDLQYKLNSIINRIPEANPLDTSSPVS
STRSWSLSSQAESHTELPADGPNGCAEQYHSPVLVSFHKWARILMSLFIDKAFCVAYQPF
LKNAKSRIWPAARQSALRHCHGFMEKFVSLATDPDFQPFQWSWPGNHQPMHATMIMLIDL
YERPYSPEAPKSRAYIDKIFSMTGPDGGVVGGEDGVSTQRPLKDGGREAWDMIRRLRQKA
WQKAGLDPHRLWSEQAQIQAGVTSLPEEYANNDPCYTSSSPTAAASPSTYPPPLTTRRQL
TDFSKMFYNMTRSHQLPNPATTNNPRPSPLRYQLPPPAPVPILPSPQSRTVPPPPFPQSP
TPPKYPMDTTTSPLASGSPISSPESITPLNPNIFASTFNNTPQQASQLPTNTPPPMQAAP
PLPSFMDTAISPTSQPITGVPTPPSMVDPNLNFDWDQWDAVFGQHLPVADELMELDPVTG
FEFGDLGSAAYASNSPSRMVPGGSSGGGGVGRGSFGSVGSGGNEVGMGEVRGSDWVGYC
NT seq 3420 nt   +upstreamnt  +downstreamnt
atgaatacaagcccaccgagcattctgcccggctacgggcagacgaacggaactccccga
tctcaatttcgctccagctatgactcccctgcgtcaggctcttcggcctctgctgctccc
aagactgggaagcctgggggccgtcagatcacccgcaatcgcgccagctacagctgccac
acctgtcggaggcggaaggtcaaatgcgacaaggttcacccaatttgcggcaactgcgta
aaaaacggtaccgaatgtgtctacgatgcggcgccacagaaggacgagtcgcgcgccagc
atatccaagaacggacatggcgtcaagcggaggagggaatcatcgcgaccgattgaggag
gatatcgatgatatacagtctatatacggtcatttgaagcaaagtggagcttccgagcag
cggtcgcaagcgattgaggcgcgtctggacaaacttacgtcgatgatagagaggctcagc
aaaacgaatcagcctttggatctcgcgggaaagcaacggctggcaccaaatgtaaaaatc
gagcaggctgagagtgatccgcgcttgaacaatatagcggccctaaagccggctgctggt
tcccgttcggatagtccgcgtcgcgcggctgaatctagtggcgatgaattcccaatcccc
gcgggccatgctactgatctagtggatcctgtagggagcctgaatcttggccatttgagc
ttggaggatggagggcgatcaagatacgtcgggacgacgtattgggcttatatttctcat
gagataaacgaactcaatcagttgctcagggatcagaatcgatcgcataacgaaccatcc
ttcaatgagagccccgttgacgatgctggaacggaacctatggctgctacaccggggcgc
cagtggaaagagtcggctgatggtgtaagcgagcctgctgagaagcttagcagaggtcag
acattccagaagtctgtcctatttccgtcaagccagtccccttccgtgactggcaagata
gtcgagccagaaatgcttgagaacatgccgacgaaacgacagagccatatactgtacaaa
ggattcatgtctggaatacacgccattaccccggttgtgcacccgccaaccatcctcaag
ctctacaactccttctgggattggtatgattcaagcagctactcaggggagtcttgcccc
gacccatcctttattcctttgctttatgctatctggtatggcggttccgtcactgtctca
ttacggacaatcaaggctgagttcaacgtgccatcccgctcgggcctgtccaaggcatac
agcgaggaggtaacgcgctggctatccaagatatctttccctcgcagtccgtccatgcaa
ggattatctgcatatctgctggtccagaccattctttccaaggaggaagaacctctaacc
agtagtctcttcatcagtcttgccatgagggtggcacagactatgggtttgcatcgtgac
cctgctaagtttggcattggcccaagcgacgctgaataccgtcgccgtatatggtggcat
attgtacacatggacggcgtggtggccatgtccagtggtctgcctcccctggtcagtgat
gagaactactgggatgttcgcgagaccagcgaggtcaaagacacgttgcttgggactcct
gctgctgagaaatatgagaggcttgttatgaccggcatgaggccaccggataatcccgat
gacccaaccgtatgtggagggccttctatggtcaatgtatactacctttcggccaagggc
aagtatacaatggctcgcgctgttcgccggattatgaagatacagcttggcacaaaaccc
gtcacacgaagggatatggaagagctgaggtcaatattggtcgatttgcagtacaagctg
aactctatcatcaaccggataccggaggcaaacccgctcgacacatcgtctccagtatca
tctactagatcatggtctctatcatcacaagcagaatcccacacggaactgccggcggat
ggacccaatggatgcgcagagcagtaccattcgcctgtccttgtatccttccacaaatgg
gcaaggatacttatgtcccttttcatcgataaagctttttgcgtcgcctatcagcccttc
ctgaagaacgccaaaagccggatctggccggcggcacggcaaagcgcactccgccattgt
catggcttcatggagaaattcgtctcgctcgcaaccgaccccgacttccaacccttccag
tggagttggccgggcaatcaccaacccatgcacgcgaccatgatcatgctcattgacctc
tacgaacgaccctacagccccgaggcacccaaatcccgcgcctacatcgacaagatcttc
tccatgaccggtccagacggcggcgtcgttggtggcgaagacggcgtctcaacgcaacgg
cctctgaaagacggcggccgcgaagcatgggacatgatccgacgcctacgccaaaaagca
tggcagaaagccggcctggaccctcacaggctgtggtccgaacaagcccagatccaagca
ggcgttacctctctccccgaagaatacgccaacaacgacccctgctacaccagcagcagt
ccaacagccgctgcctctccctcaacctaccctcctcccctcaccacccgccgccaactc
accgacttctccaaaatgttctataacatgacacgctcccaccaacttcccaacccagct
accactaataacccccgtccaagccctctccgctaccagctaccccctccagcacctgtc
cctatcctcccaagcccgcaatcaagaaccgtccctcctcctccattccctcaatcccca
acaccccccaaataccccatggacaccaccacctcccccctcgccagcggctcccccatc
tcctcccctgaaagcatcacccccttgaaccctaatatcttcgccagtaccttcaacaat
accccccagcaagcgtcgcaattacctaccaatacccctcctcctatgcaagcagctcct
cccctcccatccttcatggacacggctatctcacccaccagtcaacccatcacgggggtc
cccacaccgccctcaatggtggatccgaacttaaacttcgactgggaccagtgggacgct
gtcttcggacagcatctgccggtggcggatgaattgatggagttggacccggtcacggga
ttcgagtttggggatttggggagtgctgcttatgcttcgaattctccttcgaggatggtc
cctggtggtagtagtggtggtggtggtgtgggaagaggtagttttgggagtgttggtagt
ggtggtaatgaggttgggatgggggaggtgagggggtctgattgggtgggttattgttga

DBGET integrated database retrieval system