KEGG   Aspergillus niger: ANI_1_1458014
Entry
ANI_1_1458014     CDS       T01030                                 

Gene name
An01g10820
Definition
(RefSeq) ribosome assembly protein Noc2
  KO
K14833  nucleolar complex protein 2
Organism
ang  Aspergillus niger
Brite
KEGG Orthology (KO) [BR:ang00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ang03009]
    ANI_1_1458014 (An01g10820)
Ribosome biogenesis [BR:ang03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    ANI_1_1458014 (An01g10820)
SSDB
Motif
Pfam: Noc2 Nop14
Other DBs
NCBI-GeneID: 4977690
NCBI-ProteinID: XP_001389499
AA seq 782 aa
MAGAQKKSTKKFEKKHLKDVLERRKANAKIKQRNHLKDKRKADNAKNRAEREEATEESPE
QVQKQNAFADMNVDDFFAGGFDIADSAADLSKKARKKDVTPKIGKRKRSDEQKEEEASAA
SSAEEEGASDEDEDAASQSSDADEFEAHKDQLEALKEKDPEFYKYLKENDAELLDFGDHG
DLAEVDELSEGEEEGPAKKKKKAAKEEEEETIDNTLTIAMVKKWQKLMEEQHSIRAMRQA
VLAFRAAAHINDDAQEQKYSISDPDVYHQVLVTALSTIPRVLAHHLPVKETASGKIKVSL
DSKKFKTLTPLIKSHTSSVHELLTNLSDEQTLKLTLSSIEPMLPYLLQFRKLLKVLIKTI
VGIWADVATTEATRITAFLILRRLMIIGDAGIKETVLKASYEGVVKGSRNTTVHTLPGVN
LMKNSAAELWGVDQNVSYTTGFNFIRQLAMHLRSSITNTSKESYKTVYNWQYVHSLDFWS
RVLSQHCDGLAEAKAGKQSAMRPLIYPVVQITIGAMRLIPTAQYFPLRFQLTRSLLRLSR
STGTYIPLASSLLEVLNLSEMRKPPKSSTLRQLDFNTAIRAPKSYLRTRVYQDGVGEQIA
ELLSEFFVLWTKHIAFPELSVPIVVSLKRWLKQASSRSGGNKNAKVNQMILLLVQKVEAN
ARFIEERRLSVSYTPRNRAEVETFLKDLDWEATPLGAFVKSQRKLREEKAKILEQGRRED
EKRRAQEKEEAGKDAIMDDVISENDDSEDDDEEVEDESEADEEEEEEEEEDEDEVEFEEE
ED
NT seq 2349 nt   +upstreamnt  +downstreamnt
atggccggagctcagaagaagtccaccaagaagttcgaaaagaagcacctgaaggatgtt
ctcgaacgccggaaggccaatgcgaagatcaaacagcgcaatcacctcaaggacaagcgt
aaggccgataatgccaaaaaccgtgccgagagggaggaggctaccgaggagagccctgag
caggttcagaagcagaatgctttcgccgatatgaatgtcgacgatttcttcgcgggcggg
ttcgatattgctgattctgccgcggacttgagcaagaaggctcggaagaaggatgtcaca
cccaagattggcaagcgcaagcgctccgatgagcagaaggaggaggaggcttctgctgct
tccagcgctgaagaggaaggcgctagcgacgaagacgaggacgccgcctcccagtccagc
gacgccgatgagttcgaagcacacaaggaccagctcgaagccctgaaggagaaggatccc
gaattctacaagtacctgaaggaaaacgatgccgagttgctcgatttcggtgaccacgga
gaccttgcggaagtggacgagttgagcgaaggagaggaagaaggaccggccaagaagaag
aaaaaggccgccaaggaggaggaagaggagacgattgacaacaccctcaccattgcgatg
gtcaaaaagtggcagaagttgatggaggagcagcactcgatccgcgcgatgagacaggcc
gtccttgctttccgcgccgccgctcatatcaacgacgacgcccaagagcagaagtactcg
atctccgaccccgacgtgtatcaccaggtcctggtgacagcccttagcaccattccccgg
gttctcgctcaccacctccccgtcaaggagaccgcctctggcaagatcaaggtgtctctg
gattcgaagaagttcaagaccctcacgccgcttatcaagtcgcacacatcgtcggtccac
gagctgctcaccaacctgtccgatgaacagactttgaagctcaccctctcctccattgag
cccatgcttccctacctccttcagttcaggaagctgctcaaggtcctcatcaagaccatt
gtcggcatctgggcggacgttgctaccaccgaagccacgcgtatcacggctttccttatc
ctccgccgcctcatgattatcggcgatgccggcatcaaggaaaccgtcctcaaggcttcc
tacgaaggcgtcgtcaagggcagccgcaacaccaccgtgcacaccctccccggcgtgaac
ttgatgaagaactccgccgcagagctctggggcgtcgaccagaacgtctcctacacaaca
ggcttcaacttcatccgccaactcgccatgcaccttcgcagcagcatcaccaacacgtcc
aaggaatcctacaaaaccgtctacaactggcaatacgtacacagtctggacttctggtcc
cgcgtcctctcccagcactgcgacggcctcgcagaagccaaggcaggcaaacaatccgcc
atgcgccccctcatctaccccgtcgtgcagattaccatcggtgcgatgcgtttaattccc
acagcgcagtacttccctctccgcttccaactcacccgctccctcctccgcctctcccgc
agcacgggcacctacatccccctcgcctctagtctcctcgaagtcctcaacctgtccgag
atgcgcaagcccccgaaatccagcaccctgaggcaactcgacttcaacacagccatccgg
gcaccgaaatcctacctccgcacgcgcgtctaccaagatggcgtgggtgagcaaatcgcc
gaactcctctccgaattctttgtcctctggacgaaacacatcgccttccctgaactctcc
gtccccattgttgtctcgctgaagcgctggctgaagcaggctagctcccggtcgggaggt
aacaagaatgctaaggtcaatcagatgattctgctgcttgtgcagaaggtggaggccaat
gcgcgcttcatcgaggaacgcagattgagcgtctcttacacgccgaggaaccgtgctgag
gtggagacgttcctgaaggatctggattgggaggccacgccgctgggagctttcgtcaag
tcgcagcggaaattgagggaggagaaggctaagattcttgagcagggtagacgcgaggac
gagaagcggagggcccaggagaaggaggaagctgggaaggatgccatcatggatgatgtg
attagtgagaatgatgacagtgaggatgatgatgaggaagtagaggatgaaagcgaggct
gatgaggaggaagaggaagaagaggaggaggacgaagatgaggttgaatttgaagaagag
gaggattaa

DBGET integrated database retrieval system