KEGG   Aspergillus niger: ANI_1_304024
Entry
ANI_1_304024      CDS       T01030                                 

Gene name
An02g02260
Definition
(RefSeq) MFS transporter
Organism
ang  Aspergillus niger
SSDB
Motif
Pfam: Nodulin-like MFS_1
Other DBs
NCBI-GeneID: 4978712
NCBI-ProteinID: XP_001399367
AA seq 545 aa
MAASPHKSKRIVSVVAATLVALACGTNYAYSAWAPQFAQQMKISSTESNFIGAAGNLGMY
ASGIPLGLLTDARGPRLTTFLGAITLGIGYYPIYLAYVKGPGSMAIIFLSFFAFLTGFGS
CSAFSASIKTSASNFPDHRGTATAFPLAAFGLSAFFWSTVSSILFKDDTGRFLLLLALGT
CALNLVSIPFLRIMPPSEPYMPLGRGRSPGVESQRLRTTRSTEFRHSLEESDEAGTQTSI
TYESCPAARDRSHSVVSSPHHPGHSPDIDETSSLVSKVPSRSSREYLTQHEEDDDALSDV
ALESPHPDVRGLAMLPKIEFWQLFLTMALLSGIGLMTINNIGNSAKALWQYYDDSASPKF
IQQRQVMHVSILSFGNFIGRLSSGIGSDLLVKKLNMSRFWCLFISAFVFTITQLAGSAIS
NPHQLAIVSGFTGIAYGFLFGVFPSLVAHTFGIGGLSQNWGVMTLAPVLSGNVFNLLYGS
IYDRHSIVEPNGDRDCPDGLACYQAAYYTTFLSGVAGVVVCLWSILHERRIHGAMHKKVE
HDRLA
NT seq 1638 nt   +upstreamnt  +downstreamnt
atggccgcctcgccccataaatcgaagcggatcgtttccgtcgtagcggccaccctggtt
gctctcgcgtgtggtaccaattatgcatactcggcatgggcgccccaatttgcgcaacaa
atgaagatttcctctaccgaaagcaacttcattggcgcggctgggaatttgggcatgtat
gcatcgggaatcccattgggtctgttgacagatgctcgaggtccgcgtctgacgactttc
ttgggtgcaatcacgctgggaatcggctactatcccatctatctggcctacgtcaagggc
ccagggtcgatggccattatcttcctgtcgttttttgctttcttgacaggcttcggaagt
tgctcggcgttctcagcgtcaatcaagacatcggcttccaacttccccgatcatcgtgga
acagcgactgctttccccttggccgcttttgggctgagtgcgttcttctggtcgaccgtc
tcctcgattctcttcaaggacgatacaggccgcttcctccttttgctggctctgggcacc
tgtgccctaaacctcgtttcgatcccgtttcttcgtatcatgcctcctagtgagccatat
atgccactcggacggggcaggtcccctggcgtagaatctcaacgactacgcactactaga
tctacagaattccggcatagtctggaagaatctgatgaagcaggtacgcagacctctata
acctatgaatcctgtcccgcagcgcgtgacaggtcgcactcggtcgtgtcgagtccccat
caccccggccacagccccgatattgacgaaacatcctccttggtgtccaaagttccttca
cgctcttcccgagaatacctcacccaacacgaggaggatgacgatgctctctccgatgtt
gctcttgaatccccgcacccggatgttcgcggcttggcgatgcttccgaagattgagttc
tggcaactctttttgacgatggcccttctttctggaattggtttgatgaccattaataat
attggcaacagcgccaaggcactttggcagtactacgacgacagtgcaagcccgaagttt
attcaacagcgccaggttatgcatgtctcgattctgtcttttggcaacttcattggtcgg
ctttctagcggtattggctccgaccttttggtgaagaagctgaacatgtcgcgattctgg
tgtctgttcatctccgcctttgtcttcaccatcacccagcttgcaggctccgccatctcc
aaccctcatcaactagccattgtatccggattcaccggtatcgcctacggcttccttttt
ggcgtcttcccatcgctggtcgcccacaccttcggcatcggcggcctctcgcagaactgg
ggtgtgatgacgcttgcgcccgtgctgagcggcaacgtcttcaacctgctctacggcagc
atctacgaccgccactcgattgtcgaacccaacggagaccgcgactgtccggatggtctg
gcttgctaccaggctgcgtactacacgacgttcttgtccggcgtagccggtgtggtcgtc
tgtctgtggagcatccttcacgagagacgcatccacggcgcgatgcacaagaaggtcgag
catgaccgacttgcttag

DBGET integrated database retrieval system