KEGG   Aspergillus niger: ANI_1_2642024
Entry
ANI_1_2642024     CDS       T01030                                 

Gene name
An02g06840
Definition
(RefSeq) sec34-like family protein
  KO
K20290  conserved oligomeric Golgi complex subunit 3
Organism
ang  Aspergillus niger
Brite
KEGG Orthology (KO) [BR:ang00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ang04131]
    ANI_1_2642024 (An02g06840)
Membrane trafficking [BR:ang04131]
 Endosome - Golgi transport
  Tethering complex
   Conserved oligomeric Golgi (COG) complex
    ANI_1_2642024 (An02g06840)
SSDB
Motif
Pfam: Sec34 P53_tetramer DHR10
Other DBs
NCBI-GeneID: 4979174
NCBI-ProteinID: XP_001399819
AA seq 798 aa
MRQQAAGQRSRRQTAPSGRALEQKVKEATELETIPDGVDSITDVRNELEFAQWYNEVEES
MLEASYDEYQACLQELQMSKSHLDSLLTDTSSTLDLLTSLSNDFRAVESQTSQFRKQCEG
LLSAQKHDSDLAEDIQENLQYYDFLDPASRRLNAPGAGNTVRGKEFSDMLRRLDECLDYM
ETHPDHKEAGVYRSRYRLLMTRALTLIRTHFVSSLRDVYADASKKIADKQLNDTTMSTLL
YAKFRVGAPELKQIGLEIQKRAVPPLDPDQGTEAEYQSLLNELHANYAATRGKLIIPLVY
KNLNDLAQSPTSSQDLVSFARASISYIRGVCLDEFELWGEWFHGHGGLYDFLETICEPLY
DHLRPRIIHEDKIVKLCQLCTLLQTRYLLDQDEEIEQQIDANQLDFPALIQPALEDVQTR
LVFRAQAFLRDEIERYKPRPEDLDYPARNKQFSISVTEGQISGRKITSTDPTTTTLPNRP
KPTTKLSSDSDPASTTPEDTTATTKWDLESPTTQDQSGWYPTLRKAIWLLSRIYRLVNST
VFDDLAHQIVHQTTTSLHSASTLLSTKTTPTDAHLFLLSHLLLLKQQIVAFDIEYTTPET
TLDFSAMTSTFYELRSRGGLFNPRNLFKLVGHGLLPRVVENMLDAKVELDGRLRTVINEF
INEFAAGKMTASLPARSSSMVGLGEVMGPLCGNVEREVGSLRKVLGEYLDDGRMRETLVG
AVQDRVIQIYEEFWEMYVDAERRRGNIVSKKGKGREDEVWDVDTFAEWCEGVFRVGFVGL
GREDDGEGSMSGSGSVRS
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgcgccaacaagctgcaggacagcgaagtcgacgccagactgccccgtcgggccgggct
ctggaacagaaggtcaaggaggctacggaactcgagacaatcccggatggtgtggactca
attactgatgttcgcaacgagctggagtttgcgcaatggtacaatgaagtagaggagagc
atgttggaagctagctacgatgaataccaagcttgcctccaggagcttcaaatgtccaag
tcccatctcgattccttgttaaccgatacttcgtcaaccctcgaccttttgactagcctc
tcgaacgacttcagagccgtggaatcacagacctcccaattccggaaacaatgtgagggg
ctactctctgcgcagaagcatgactccgatttggcggaggatattcaggagaacctccag
tactatgactttctagaccctgcgtcgaggagactgaatgcccccggggctgggaatacg
gtccgtgggaaggaattctcggatatgctacgacggcttgacgaatgcctggattacatg
gagacacatcccgatcacaaagaggccggcgtataccgctccaggtaccgtttgctcatg
actcgcgccctcaccttgatccgaacccactttgtgtcctccctccgagatgtatacgcc
gatgcgtcgaagaagatcgcagataagcagctcaacgatacaaccatgtccactctgctc
tacgccaaattcagagtcggcgcaccagaactgaagcagatcggactcgagattcagaag
agagccgtcccgcctctagatcccgaccagggcaccgaagccgaataccaaagcttgctg
aacgagcttcatgcgaactatgcagccacacgcgggaaactgatcatcccactcgtatac
aagaacctcaacgaccttgcacagtctccaacatcatctcaggatcttgtctcttttgcc
cgcgccagcatcagctacatccgcggcgtatgcctcgacgagttcgaactatggggcgaa
tggtttcacggccacggcggactctacgacttcctggaaacaatctgcgaaccgctctac
gaccacctccgaccacgaatcattcatgaagacaagatcgtcaagctctgtcagctctgc
accctcctgcaaacccgatacctgctcgaccaggacgaggaaatcgagcaacaaatagac
gccaaccagctcgacttcccagcgctgatacaacccgcgctcgaagacgtccaaacccgc
ctcgtcttccgcgcgcaggccttcctccgcgacgagatcgagcgctacaagcctcgcccc
gaagacctagactacccagcacgcaacaagcaattctccatatccgtcaccgaaggccag
atcagcggccgcaagatcacctctacagaccccaccaccacgacgctcccgaaccgtcct
aaacccacaaccaagctcagcagtgacagcgacccagcatcaacaaccccagaagacacc
accgccacgacaaaatgggacctcgagtccccgacaacccaagaccaaagcggatggtac
ccgaccctccgcaaagccatctggctcctcagccggatctaccgactcgtcaactccacc
gtcttcgacgacctcgcgcaccaaatcgtccaccaaaccaccacctccctacacagcgcg
agcactctcctatcgacaaaaaccacccccaccgacgcccacctcttcctcctcagccac
ctcctcctactaaaacaacaaatcgtcgccttcgacatcgaatacaccaccccggaaaca
accctcgatttctccgccatgacatccaccttctacgaactccgctcacgcgggggtctc
ttcaacccgcgcaacctcttcaaattagtaggccatggcctcctcccccgcgtcgtggag
aacatgctcgacgcgaaggtcgagctagatggacggctccgcacggtcattaatgaattc
attaatgagtttgcggccgggaagatgacggcttcattgccggctaggagttcctctatg
gtagggctgggggaggttatgggtccgttgtgcgggaatgtggagagggaagtggggagt
ttgaggaaggtgttgggggagtatttggatgatgggcggatgagggagacgctggtgggc
gcggtgcaggatcgggttattcagatttacgaggagttttgggagatgtatgttgatgcg
gaacggaggagggggaatatcgtgagtaagaaggggaaagggagggaggatgaggtttgg
gatgtggatacgtttgcggagtggtgtgagggggtgtttagggttgggtttgttgggttg
gggagggaggatgacggtgaggggagtatgagtgggagtgggagcgtgaggtcttga

DBGET integrated database retrieval system