KEGG   Aspergillus niger: ANI_1_1268024
Entry
ANI_1_1268024     CDS       T01030                                 

Gene name
An02g08840
Definition
(RefSeq) kinesin family protein
Organism
ang  Aspergillus niger
SSDB
Motif
Pfam: Kinesin Microtub_bd KLRAQ bZIP_2 DUF1499
Other DBs
NCBI-GeneID: 4979375
NCBI-ProteinID: XP_001400018
AA seq 733 aa
MSSTKSSPASLFQVYLRLRPPMPQHLEEHAERCLTIETPEPKVTVEDGQETAAAFPTHIT
LQPPSDARKRAVERFGFTKVFEESASQLDVFHGTELDSLVRGVLVEGRDGLIATLGVTGS
GKSHTILGSKSQRGITQMSLDLIFNSLASTIRPPDNSISPLLLSTVAASDGSEAQMFTAQ
TFLEAVYGDPAERGRNSRAQTPMSTGRATPMTEPTPALIFPRRNMPQRPNGLLRSPDVSH
LTMELNPNSEYVVLVSMYEVYNDRIFDLLSPAIVPGQGSTMSRQGGNSQKDRRRALFFKP
TEGSPDRKVVAGLRKIACSTYEEALSVLEVGLTERKVTGTGANSVSSRSHGFFCLEVKRR
MRNKRTGEETWIGNTLTVADLAGSERARTAKTAGSTLAEAGKINESLMYLGQCLQMQSDI
QDGNKAAMVPFRQCKLTELLFSNSFPSSNQTTGFNRHPQKAIMIVTADPMGDYNATSQIL
RYSALAREVAVPRAPSIAESILSSTLGSRHGSASGRNTPSMGTNEELEKALAEIARLTTE
NESLSVRLAEEEILRTDFELRLKASEERCILIEQEVREECWNEMDERMEEERKRWQNALD
QQSGFNDEHLDKKIEIVSRGFQIYEDPKPSSDERVEDLEFENDQLRSKIAALERELNCRS
PTKKSRSKNTLEASRNSNIFGRESDIEVALKRMDQLKLADSMFSPAPQPASSPGKRQRKM
ATRKWDLAPEEDI
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgagctcgacaaagtcctcccccgcatctctattccaggtgtacctccgcctgcggcca
cctatgccgcagcatttggaggaacacgccgaacgatgcttgacaatcgagactccagag
ccaaaggtcactgttgaagatggccaggaaacggcagctgcatttcccactcatatcacc
ctgcaacccccatccgatgctagaaagcgtgccgttgaaaggttcggtttcaccaaggtg
ttcgaagagtcagcgtcccaactagatgtcttccatggcaccgagctggactccctggtt
aggggggtattggttgaaggcagggatggccttattgcgacgttgggagtaacaggtagc
ggaaagagccatacaatcctaggttcgaagtcgcagcgaggaattacccagatgagcctt
gaccttatcttcaattctctggcctctactatcaggccacccgacaattccatcagccct
cttctcctgtcaactgtggccgcgtcagacggttccgaagcccaaatgttcacggcgcaa
acattcctcgaggctgtgtatggcgaccctgccgaacgtggaagaaactcgagagcccag
acgccaatgagcactggaagagctacccctatgacggaaccgacacctgcccttatattc
ccccgtcgcaatatgccccaacgtcccaacggcctgcttcgctcgcccgatgtcagccac
ctcaccatggagctgaaccctaattccgaatatgtcgtccttgtgtcgatgtacgaagtt
tacaacgatcgcatctttgatctactgtcacccgctatagtaccgggccaaggaagtacg
atgtcccgtcagggaggaaattcacagaaggacagacgcagagccttgttttttaagcca
acggaaggctcccctgaccgcaaggttgttgcgggactgcgcaagatagcatgcagcacc
tacgaggaggctttgtcggtcctcgaagtcggccttactgagcgcaaggtcactggaacc
ggagccaacagcgtcagttcccgtagtcatggtttcttctgtttggaagtcaagagaaga
atgcgaaacaagagaactggtgaagaaacttggataggcaacacgctcacggtggcagat
cttgctggttctgagcgcgcgcggactgctaaaacggctggttcgaccctggcagaggcc
ggcaagattaacgagagcttgatgtaccttggccaatgtcttcaaatgcagagtgacata
caggacggaaataaggctgccatggtcccattcagacaatgcaagctcaccgagctactt
ttctcgaactctttcccgtcttccaaccagactactggcttcaaccgccacccacagaag
gccattatgattgtcactgccgatcccatgggagattacaacgcgacttcccaaatcctg
cgctactcggcattagctcgtgaagttgccgtgcctagggccccctcaattgccgaatct
atcttgtccagcacactcggatctcgtcacggatctgccagtggacgcaatactcccagc
atgggcacaaacgaagagcttgagaaggccctggcggaaatcgcgaggttgaccacagag
aatgaatctctctcagtgagactcgccgaggaagagattctccggactgatttcgagcta
agactcaaggcaagcgaagaaagatgcatcttgatcgaacaagaagtgcgcgaagaatgt
tggaatgagatggacgagcgcatggaagaagagcgaaagagatggcaaaatgccttggat
caacaatctggtttcaacgacgagcacctcgacaagaagatcgaaatcgtgtcacgagga
ttccaaatttatgaagaccccaaaccctcctcagacgagcgggttgaagacctcgagttt
gagaacgaccagcttcgcagcaagatagcagcccttgaacgcgaactgaactgccgctct
cctaccaagaaatccaggtcaaagaatactctagaagcttctcgcaactctaatatcttc
ggacgcgagagtgatattgaggttgctctcaagcgaatggaccagctaaagcttgcggat
agcatgttctctcctgcaccgcagcccgctagttcacctggcaagagacaaagaaagatg
gccactcggaaatgggacctggcccccgaggaagatatctga

DBGET integrated database retrieval system