KEGG   Aspergillus niger: ANI_1_2892024
Entry
ANI_1_2892024     CDS       T01030                                 

Gene name
An02g09420
Definition
(RefSeq) cytochrome P450
Organism
ang  Aspergillus niger
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4979432
NCBI-ProteinID: XP_001400072
AA seq 524 aa
MNIPQGLPTLKWSGIVSIGLTRGAFVCLFAIFVVAYVVGLVFYRLCLSPLAKFPGPRLAA
ATGLYETYYDVIRDGQFTWHIERLHQKYGPVVRINPWEVHVKDADKYNTLYSGPTRKRNK
DAWFSFVGWPQAIVSTEQHALHRTRRSVLRQFFSDQAILSSEPLIRANIQALCRHFRSAQ
SRHYSLELHTAFLCFTSDTISQYAFGKRIGFHSLDQPELSTASKTKLNSTFELVQTTRHF
PWLCKLAHVFPWPAKLLNADFVGAYLQEKEVQDMVRKTITERDTGSSEEHRAIYPAILDD
EKVPEDEKKFSRLTDDAIFLLLAGTDAPGRALVMSLYYILQHPEVYERVRAELCASWTDA
STEPRLTTLKQLPYFTAVLKEGLRLSALVTTRLPRAAPDEILQFHGWEIPRGTPVSMTTY
FILRDPEIFPEPSRFIPERWLLEPEDLRKLERYLVPFSKGTMGCLGPNMAWAWLYLVLGT
LLRKFEMKLHDTTERNVEMVRDKFLGQTERGMNRVQIKVLREYA
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgaatatcccacaagggttgccgacgctgaagtggagcggcattgtgagcataggcctt
acaagaggggcatttgtatgcttatttgccatttttgtcgtcgcctacgtcgtcggactt
gtcttctatcgactctgcctcagccccctagctaagttccctggtccccggttggccgcc
gcgacagggctctatgaaacttactatgatgtgattcgcgacggtcagtttacctggcac
atcgagcgtttgcatcagaagtatggtcccgtagtgcgcatcaatccatgggaagtccac
gtgaaagacgcggacaagtacaacacgctgtactcaggaccgacgcggaagcgaaacaaa
gatgcttggttctcgttcgttggatggccccaggcgatagtctcaacagaacaacacgca
ttgcatcgcacccgacgaagcgtgttgagacaatttttcagtgatcaagccattctgtct
tcagagcccctgatccgggcgaatatccaggctttgtgtcgtcattttcgcagtgcacaa
agcagacactatagcttggagctccataccgcgtttttatgttttacaagtgatactata
tcacaatatgcattcgggaaacggatcggctttcactctctggaccaaccggaactgagt
acggctagcaagacgaagttgaactctacatttgagcttgttcaaacaacaagacatttc
ccctggctctgcaagctggcacacgtctttccttggccagcaaaacttctgaatgcggat
ttcgtcggggcctatttacaggaaaaggaagtccaagacatggttcgcaagaccataacg
gaacgtgatacagggagcagcgaggagcatagggcaatttatcctgcgattctagacgat
gagaaggtacctgaggacgagaaaaagttctcacgcctgactgatgatgcgatctttctg
ctgcttgccggtaccgatgcgccaggaagagccttggtcatgagtttatattacattcta
caacacccagaggtgtacgaaagagtccgcgctgaattgtgtgcttcttggacagatgcc
tcgacggagccgcgacttacaacgttaaagcagttgccttatttcaccgccgtgttaaag
gagggactgcgattgtccgctctcgtcaccacacgcctcccacgtgccgcgccggatgag
atcttgcaatttcacggatgggaaattccacgcgggactcctgtgagcatgaccacctat
ttcatcctccgtgatccagagatctttcccgagccgtcgcgattcatccctgagcgctgg
ctcctagagccagaagacttacgaaagctggagcgttaccttgttccattctccaaaggg
accatgggatgcctgggtccaaatatggcttgggcatggctatatttggttctcgggaca
ctcctgcggaaatttgagatgaaacttcatgacaccacagagcggaatgtcgagatggtc
cgagataaattcctcgggcagacggagcgtggaatgaatcgggttcagatcaaggttttg
agggagtatgcgtga

DBGET integrated database retrieval system