KEGG   Aspergillus niger: ANI_1_1482024
Entry
ANI_1_1482024     CDS       T01030                                 

Gene name
An02g10560
Definition
(RefSeq) ankyrin repeat-containing protein
Organism
ang  Aspergillus niger
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3
Other DBs
NCBI-GeneID: 4979547
NCBI-ProteinID: XP_001400185
UniProt: A5AAG3
AA seq 353 aa
MRASRVGAQLPIELTLLAAEYLTPVDLLSLLYAVPGLVRSLTFHHTTLQDEGGRTILHLL
ARDGELLKLLLANGSIRPDPKDNCGRTPLSYAAEKYEVAVKLLLDRQDVEADSKDNLGRT
PLSYAAGSGYEAVVRLLLDQGVEADSKDNLGRTPLLYAAWHGHEAVVRLLLDQDVEANLK
DNDGLTPISCAAGAGHGAVVRLLLDRQDVEADSKDNLGRTPLLYAAWRGHEAVVRLLLDR
QDVEADSKANWGQTPLSFAAGGGHEAVVRLLLGRPDVEADSRDNLGRTPLLYAAWRGHEA
VVRLLLDQQDVKVDSKANWGRTPLSCATEGGHEAVVRLLLGRQDGQTDTKDNC
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgagagcgtctagggtaggagcccagctccctatcgaacttaccctgcttgccgccgaa
tatcttacacctgttgacctgctctctctcttatatgcagttcctgggcttgtacggtcc
ctgacttttcaccataccacgcttcaggatgaaggagggaggacgatcctacatctactc
gcgagggacggcgaattgctgaagctactactcgcaaacggcagtatcaggccagacccg
aaggataattgtggccggacaccgttatcttatgcggctgaaaaatatgaagtggcggtc
aagctactgctagaccgacaagatgttgaagcagactcaaaggataacctaggtcggaca
ccattatcctatgcagctgggagtggatatgaagcagtggtcaggttactgctggatcaa
ggtgttgaagcagactcaaaggataacctgggtcggacaccattgttatatgcggcctgg
cacggacatgaagcagtggtcaggctattgctggaccaagatgttgaggcgaacctaaag
gataatgacgggttgactccgatatcctgtgcagctggagcggggcatggagcggtggtc
aggctactgctggaccgacaagatgttgaggccgactcaaaggataacttgggtcggaca
ccattgttgtatgcagcctggcgcggacatgaagcagtggtcaggttactgctggaccga
caagacgttgaggcagactcgaaggctaactggggtcagacaccattgtcctttgcggct
ggaggtggacatgaagcagtagtcaggctactgctgggccgaccagatgttgaggcagac
tcgagggataacttgggtcggacaccattattatatgcagcctggcgcggacatgaagca
gtggtcagattactgctggaccagcaagatgttaaggtggactccaaggctaactggggt
cggacaccattatcctgtgcgactgaaggtggacacgaagcagtcgtcaggctactgctg
ggccgacaagatggccagacggacacgaaggataactgttga

DBGET integrated database retrieval system