KEGG   Aspergillus niger: ANI_1_1212034
Entry
ANI_1_1212034     CDS       T01030                                 

Gene name
An03g02890
Definition
(RefSeq) single-stranded DNA endonuclease
  KO
K10846  DNA excision repair protein ERCC-5
Organism
ang  Aspergillus niger
Pathway
ang03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    ANI_1_1212034 (An03g02890)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_1212034 (An03g02890)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     ANI_1_1212034 (An03g02890)
SSDB
Motif
Pfam: XPG_N XPG_I 5_3_exonuc UIM XPG_I_2 HHH_5 Transposase_20
Other DBs
NCBI-GeneID: 4980279
NCBI-ProteinID: XP_001390185
AA seq 1100 aa
MGVQGLWTVVHPCARPIKLETLNKKRLAVDASIWIYQFLKAVRDKEGNALRNSHIVGFFR
RICKLLYFGIQPVFVFDGGAPVLKRQTIANRKKRREGRREDAVRTAGKLLAVQLQRSAEE
EAATRRRGRTENEEEVPDNPVYVGDAFITEQEKQQTRSFKKKDAYHLPELQTSLEEMGAP
NDPRIIPFFVSLPATDRYNILNAARLRSRLRMGYSKEQLDSMFPDRMAFSKFQIERVKER
NDLTQRLMNINGMNGEDALYKSGQRIAGERGKEYVLVKDDTIEGGWVLGVVGNKEGQEDK
PIDADQYGQQLIFPDKEDDSNDDDGGFEDVPIEGFNRLPKLPFLQKGGFDEPNRNQMRDS
LNTRGPELQAANEDSLFVEGGQDEFLSKHNRHTADTLFDISGDDDDETLQRAIAMSLEPG
GDINNDDLPEIQLNQNHMSLPTIDEAPANVTDHSDDEGMDFVAALAQSKRIKKAPSKVAD
NPFDGPLPFESLKPLKTGKSLNRAQIPEQDAGAKTSDKEPSKTKDNQPLPPWFSGPSQTV
KNVEFVSDEVDLRPVAKPPTEQNIPDHVFIVGDEDATEDHNLESSKGSKPFIDLEDPTPQ
LNVVSQEVQIKRENRPEITPVEAQATETKDAEALEAHMGDSVPVDASNHSMTKHTSFDDK
PDLRHIEKSPSPEFEDVVLQPDNVPAEPIALDQSDQVEEYYDEEIFSDPEDEQLLEQLAA
EGEEHVRFAATLNSTSHTELPFDYEQELRQLRSQQKKDRRDADEVSQVMITECQQLLRLF
GLPYITAPMEAEAQCAELVSLGLVDGIITDDSDVFLFGGTRVYKNMFNQSKFVECYLTTD
LEKEYSLFRTKLIRLAHLLGSDYTEGIPGIGPVTALEILTEFGTLEDFRDWWTQVQTGLN
MGNDSHATFYKKFKKHATKIFLPPSFPDPRVDAAYLEPEVDSDPSPFQWGVPDLHGLRDF
LMSTIGWSQERTDEVLVPVIRDMNRRDQEGTQSNITSFFSGPQGAGAFAPRVRSGGQTRM
EKAFSRLRQQAASVEQPDSTGVDGYLVDPAADNSLESPVTSTRKEARTKRGRHGGRTTKD
GHEDITDRTATNKKRRTRAK
NT seq 3303 nt   +upstreamnt  +downstreamnt
atgggtgtccaggggctctggacggtcgtacatccttgtgcacggcccatcaaattagaa
actctcaacaaaaagcgcctggctgttgacgcatcgatatggatatatcaatttttgaag
gcggtacgcgacaaagaaggcaatgccctccggaactctcatatcgtgggcttctttcgg
cgcatatgcaagctcctctactttggtattcagccggtcttcgtgtttgacggtggcgct
ccagtactcaagcgccaaactatagcaaaccggaagaaacggcgcgagggtcggcgagaa
gatgccgtgcggaccgctggaaagctgctggctgtgcagctgcaaaggtctgctgaggaa
gaggcggctacccgccggagggggagaacggaaaatgaagaggaggtgccagacaaccca
gtttatgttggtgatgctttcataaccgaacaggaaaagcagcagacgcgctcgttcaag
aagaaggacgcctaccatctgccggagttacaaaccagtcttgaagagatgggggccccc
aatgaccctcgtatcatcccattcttcgtcagtctcccggcgacggaccggtacaacatt
ctcaatgcggccaggctccgaagccgtctccggatggggtactcaaaggagcaactagac
agcatgtttcctgatagaatggcattctcgaagtttcaaatcgagcgtgtaaaggagcgc
aatgacttaacgcagcgcctgatgaatattaacggcatgaacggtgaagatgctctgtac
aaatcaggacaacgtattgccggagaacgcgggaaggagtatgtcttagtgaaggacgat
accatcgaaggtggctgggttttgggtgttgtgggaaataaggaaggtcaagaagataaa
cctatcgatgctgaccaatatggtcagcagctgatattcccagataaagaggatgattcg
aatgacgatgacggaggatttgaagatgtacctattgaaggattcaaccgactccctaag
ctgccttttctccagaaagggggtttcgatgagccaaacaggaatcagatgcgtgatagc
ttgaatacgagaggccccgagctgcaggcagccaacgaagactcccttttcgtggaaggt
ggtcaggatgaattcctatcgaagcataaccgccatactgcagatactttgttcgatatt
agtggagatgatgatgacgaaacgcttcaacgagcgatcgcgatgtcactcgaacctgga
ggggatatcaataatgatgatctacctgaaattcagcttaaccagaaccatatgtctctt
ccaactatcgatgaggccccggcaaacgttacggatcatagtgatgacgaaggaatggac
tttgtcgccgccttagcacagtctaagagaataaagaaagcaccgtccaaagtggcagat
aatcccttcgatggtccgctaccctttgagtcacttaaaccgctcaaaactggaaagtca
ctcaatcgtgctcaaatacccgaacaagacgctggcgccaaaacatccgacaaagaacca
agtaagacgaaggataaccagccactgccgccgtggttctcagggccatcgcaaactgtc
aaaaatgttgaatttgttagtgatgaggttgatcttcgtccagtggcgaagccgcctact
gagcagaacataccagatcatgtgttcatcgttggcgatgaagacgcgacggaggatcat
aatttagagtcttcaaaaggctcaaagccattcattgacttggaggacccaactcctcaa
ctgaacgttgttagtcaagaggttcaaatcaagcgcgagaatagaccagaaataactcct
gtcgaagcacaagctactgagacaaaggacgccgaagctttggaggcacacatgggagat
agtgtcccagtggatgcgtctaatcattctatgacgaaacacacctcctttgatgataaa
ccagatttgaggcatatcgaaaagtcgccttcgcctgagttcgaggatgttgtcttgcag
cccgacaatgtacccgcggaacccattgcactagatcaatcagatcaagtggaggaatat
tatgatgaggaaattttctcagatcctgaagacgagcaattactcgaacagcttgcggct
gaaggggaagagcatgtacgctttgcagcgacactaaactctacttctcacacagaactt
ccatttgactacgagcaagaactgagacaattgcgatctcagcaaaagaaggaccgcaga
gatgcagacgaagtgtcacaagtcatgattactgaatgccagcagttgctgaggctattc
ggtcttccatacatcacggcccctatggaagctgaagcccagtgtgcagaactggtgtca
ctcggccttgttgatggtatcatcaccgatgatagtgatgtgtttttattcggaggaaca
cgcgtttacaaaaacatgttcaaccaaagcaagtttgtcgaatgctacctcacaaccgac
ctggagaaagagtactctttgtttcgtaccaaactcatcaggcttgcccatctattagga
agcgactacacagagggcatccccggcatcgggcctgtaactgctctagagatcctcact
gaattcgggaccctggaagacttccgtgattggtggactcaggtgcaaacaggactcaac
atgggcaacgatagccatgcaacattctacaagaagttcaaaaagcatgcgactaaaatc
ttcctaccaccatctttccccgatccccgagtcgatgccgcgtacctggaaccagaggtg
gactcggacccgtctcccttccagtggggagtacccgacttacatggcctgcgggacttc
cttatgtcaacaatcggctggagtcaagaacgcactgatgaggtcctggtgcccgtaatt
cgcgacatgaaccgcagagatcaggagggcacacaatcgaatattactagtttcttcagc
ggtccacaaggagcgggtgcctttgcaccacgtgttcgcagtggtggccagacaagaatg
gagaaagcatttagtcgactccggcagcaagctgcatctgtggaacagccggattcaact
ggcgtagatggttacttggttgatccagccgcagataattccttggagagtccagtaacg
tcaacaaggaaggaggcgcgcaccaaacgagggcgtcatggaggacgaactacaaaggat
gggcatgaagacatcacggacaggaccgctaccaacaaaaaacgtcggacccgcgccaag
tag

DBGET integrated database retrieval system