KEGG   Aspergillus niger: ANI_1_1570184
Entry
ANI_1_1570184     CDS       T01030                                 

Gene name
An04g00870
Definition
(RefSeq) DNA mismatch repair protein (Mlh3)
  KO
K08739  DNA mismatch repair protein MLH3
Organism
ang  Aspergillus niger
Pathway
ang03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    ANI_1_1570184 (An04g00870)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_1570184 (An04g00870)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     ANI_1_1570184 (An04g00870)
Motif
Pfam: HATPase_c_3 MutL_C HATPase_c
Other DBs
NCBI-GeneID: 4990489
NCBI-ProteinID: XP_001401452
AA seq 943 aa
MSSWDPKIRPLPPDVVAKLKSSTAITHLNGVIVELVKNALDANARTVCVTVDFVRGGCIV
EDDGDGIPPAEFGPDGGLGKAHHTSKYHSNHTIEGRKGLFLASLAALSLLTITSHHVRHS
STNTVTFHHLTPVARLMPAPVYQELRFSAHGTSVTVNDLFGNMPVRVKSRALALQRPDEL
ERQWDELRHFLVSFMVANDRVAKLVILDAHRDKKITVCPQGLARQYGGEPDLQRLRSILA
QSGLVGAQNTGIWDTVSASVSDFTIHAAVSLTPSPTKKVQFVSLGSTPVFARSNANLIYA
EVNRSFALSDFGSMKNCSSAVEAPVRAADGQLMHSKPASKAVNKWPMFYIRIDSCNEWSI
DDDTQELPESDKSLQRIIDVLSTMINEFLRQSSLRPRTGKRKRSTPNVPPATTRHSSVKA
GRSLSPGGEVSATEETLGNQLRLPSLRRPPNVSHHFGDWTRIKSAKPETVSKRFPLRGRE
PRSTRSENYPAHQVQDHLNQQPALLSASNEGTATEPRSPVLEEPEKHEEQLNQIHEETAT
DRMTPWVDPYTGRRHLINSRTGQSILHGSSVAADVALRPRSTGCLPEPHRAPDEVQRPRS
VDLQRTDNKWVEKLLDNWINPVFGRPERPISAMDVSAGHETARPGSSSRNNQGELCGFES
MGVSKFRGKLRKQDLRAAEIIAQVDQKFILVKMQLPSNSPGEPASNLILIDQHAADERCR
VEALMAELFTSEEDSPGSIQTITLDPIIFEIPATEASLFERYRNFFHSWGVAYTMEQGPK
DKNVFIFVHTLPTLIAERCRTEPNLVSDLIRGEIWKREEENGRSRQPHHPTGFGASRPDM
AQTSSSWVDRLDGCPRGIIDLLNSRACRTAVMFNDVLDKNECQSLVRRLADCVFPFQCAH
GRPSMIPILEMGAAVSLDQTQSDEYEGPGFVGMFRKWQDAKTG
NT seq 2832 nt   +upstreamnt  +downstreamnt
atgtcgtcatgggatcccaagatacggcctctaccgcctgatgtagtggcgaagctcaaa
tcctcaactgccattacacacttgaacggagtcattgtagagctagtcaagaatgcatta
gatgcaaatgcccgcacagtctgtgtcacggtcgacttcgttcgcgggggctgtatagtc
gaagatgatggagatggcattcctccagcggagtttggaccagacggaggattgggaaaa
gcgcaccatacttcaaaataccattcgaaccatactattgaaggacgcaaagggcttttt
cttgcctcgcttgcagctctttctctgctgacgatcacgtcacatcatgttcgccattcg
agtactaatactgtcactttccatcacttgacgccggttgctcgtttgatgccagctcca
gtttatcaggagctgaggtttagtgcccatggcacctctgtcacagtaaatgatctgttc
gggaatatgcccgtgcgcgtaaaaagccgagccttggctcttcaaagaccggatgagctg
gagcggcagtgggatgaattgaggcactttttggtgtcgttcatggttgcaaacgacagg
gtggctaagctagtgatcctagacgctcatagagacaaaaagattacagtttgcccccag
ggacttgcaagacaatatggcggggagcctgatctacagcgactgcgttccatcctggca
cagtcggggcttgtcggggctcagaatacgggcatatgggataccgtatcagccagcgtt
tccgacttcacgattcatgcagcagtctctttgacgcctagtcctacgaagaaggtccag
ttcgtctctttaggctcgaccccggtgttcgcgaggagcaacgcgaatctgatctatgcg
gaagtcaatcgctcatttgccttgtcggactttgggtctatgaaaaactgctcctctgca
gttgaagcgcccgtccgggctgctgatggccaactcatgcatagcaaacctgcgtctaaa
gcagtcaataaatggccaatgttctatatacgtatagacagctgcaatgagtggagtatc
gacgacgacacgcaagaacttccggaatcagacaagtccctccaacgtatcatagatgtg
ctttcgacaatgatcaacgaatttctcaggcaaagcagcttacgcccacggactgggaaa
aggaaaagaagtacgcccaatgtaccaccagctactacgcgccatagcagcgtgaaggcc
ggaaggtctctatctccaggaggtgaagtctccgccaccgaagaaactctcggcaatcag
ctcaggctcccctctttgcgaagaccacccaatgtcagtcatcacttcggagattggacc
aggataaaaagtgcgaagccggaaacggttagcaagaggtttcctttacgcggtcgcgaa
cccaggtcaactcgctcagagaattacccagcacatcaagtccaggatcatttgaaccag
caaccagcgctcctatctgcaagcaatgaaggcacggccactgagccccgatctcctgta
ctggaagaaccagagaagcacgaagagcaacttaatcagattcatgaagagacagctacc
gacagaatgacgccatgggtcgatccttacacgggtagacgccacttaatcaactcgcgc
actggtcagtccatactccatgggtcttcagtagcagcggacgtggcgctgcggccccgg
tccactgggtgtctaccagaaccacatcgcgctccagatgaagtgcagcgaccaagatcg
gtcgatctgcagaggaccgacaacaagtgggttgagaaacttttggacaattggattaac
cctgtttttggtcgcccagagaggcctatcagtgcgatggatgtcagtgctggccacgag
acagctcgccccgggtctagctcgcggaacaatcagggcgagctatgcggtttcgaaagc
atgggagtgtcgaagtttcgcggcaaactgcgcaaacaggatttaagagctgcagaaatt
atcgcccaagtggatcagaaattcatcctggtaaagatgcaattgccctccaatagccct
ggggagcctgcatcaaacctgatcttgatcgatcagcacgctgcggatgaacgctgccgg
gtcgaggcactcatggcagagctgttcacatcagaagaagatagcccgggctccatccaa
accatcacattggatcccattatttttgagatacccgctaccgaagcatccctatttgaa
cgatatagaaatttcttccactcttggggtgtagcttacaccatggaacaaggacccaaa
gacaagaacgtcttcattttcgtacacaccctcccaaccctcatcgccgagcgctgccgc
accgagcccaacctagtctctgacctcatccgcggcgagatctggaaacgcgaagaagaa
aacggccgaagccgacagcctcaccatcccaccggcttcggcgcttctcgtccagatatg
gcccaaaccagcagcagttgggtagaccgactcgacggctgtcctcgagggatcatcgac
ctgctgaactctcgcgcatgccgcacggcagtcatgttcaatgatgttctggacaagaat
gaatgccagagtttggtccgacgactcgcagattgcgttttccctttccagtgcgcgcac
ggccggccctcgatgatacctattttggaaatgggggctgctgtatcattggatcagact
cagtcggatgaatatgaaggtcctggttttgttggcatgtttaggaaatggcaggatgcg
aagactggttag

DBGET integrated database retrieval system