KEGG   Aspergillus niger: ANI_1_1744184
Entry
ANI_1_1744184     CDS       T01030                                 

Gene name
An04g03330
Definition
(RefSeq) pantetheine-phosphate adenylyltransferase family protein
Organism
ang  Aspergillus niger
SSDB
Motif
Pfam: CTP_transf_like
Other DBs
NCBI-GeneID: 4990739
NCBI-ProteinID: XP_001401701
UniProt: A2QIF5
AA seq 401 aa
MASDQLSALLLLPPPPSASFNEFKAAYEPVLLGVCTKLVRELNGANHTAILDIALSLPGL
LSPSCRPRTRAFSSLQSLLESIYRLIGIVCVEQGIELDGPGGIDPRVILLDYDSVQTAVT
RDNPCDGPIIDLQTLARSGRLWDYIYYPDNQVGQGLATAFSSFYSESRDPNGGSMSAIPD
APNWKAAESLLVMDDNHTSTTHYSVAVGGTFDHFHIGHKLLLTATALVLQPAEDVEAGNV
RKITVGVTGEGLLAKKKYAEYLESWDERCMSTGSFLSAIMDFRLPETSAPRIERESGSGP
DDKYIQMQMRPDLVFKLVQITDPFGPTVTDKGISALVVSKETRAGGSAVNEERAKKGWES
LEVFEVDVLHTGEVPTDDAESFASKISSTDIRRRRMEMATE
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggcttcagatcaactttcggccctgcttctgctgccgccacccccttcggcatcattc
aacgagttcaaggctgcatatgagcccgtcctgttgggtgtttgcaccaagcttgtccgc
gaactcaatggagccaatcacacggctatactagatattgcgctctctcttcctggcctc
ctatccccctcatgtcggccacgcactagggcattttcaagcctccagtctcttctggaa
agcatctataggcttattgggattgtatgtgttgagcaaggcattgagcttgatggtccg
ggtggtattgacccccgtgtgatcttgctcgattacgactcggtccagactgccgtcacc
agggacaatccgtgtgacggccctatcattgacttgcagacattggcgcggtctggacga
ctgtgggattacatatactacccggataaccaagtaggtcagggtctagcaacggccttc
agtagcttctattctgagtccagggaccccaacggcggatccatgagcgcaatcccagat
gcacccaactggaaggctgcagaatcccttttggtgatggacgataaccacacatcaact
acgcattactctgtggctgtaggaggcactttcgatcactttcacattggccacaagctt
ctgctcacagctacggcattggtattgcagcctgctgaagacgtggaggcaggtaatgtc
cggaagatcaccgtcggggtgacaggggaaggtttgctggcgaagaagaagtatgctgaa
tatttggaaagctgggacgagcgatgcatgagcactgggtcattcctctcggccatcatg
gatttccgtctcccagaaaccagtgcgccgcgtattgaacgggaatctgggtctgggccc
gatgacaagtacattcagatgcaaatgcggccagatctagtcttcaagctggtacagatc
acagatccttttggccctaccgtcaccgacaagggaattagtgctcttgttgtttccaag
gaaactcgtgcaggtgggagcgcggtcaatgaggagcgtgcaaagaaaggctgggagagc
ctggaggtgtttgaagtcgacgtactacatacaggcgaagttcccaccgatgatgccgag
agcttcgcgtcgaagataagcagcacggatatcagacggcgtcggatggagatggcaacg
gaataa

DBGET integrated database retrieval system