KEGG   Aspergillus niger: ANI_1_858184
Entry
ANI_1_858184      CDS       T01030                                 

Gene name
An04g05060
Definition
(RefSeq) C2H2 finger domain protein
Organism
ang  Aspergillus niger
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 4990913
NCBI-ProteinID: XP_001401870
UniProt: A2QIX4
AA seq 284 aa
MAPGGGRDFNCTWEHCNKSFNRKSDLCRHYRIHTNERPYHCTVKDCNKSFIQRSALTVHS
RTHTGEKPHVCDHRGCHKAFSDSSSLARHRRIHTGKRPYICQEPTCERAFCRKTTLTKHQ
HRSHPPGSMTRLPSEDAVSEHSYQGPVAVPVPNEQYLLAQQPYYPHTPTPTHEFYPHQSL
HITPVPIQEQPPIVTQHIPVTSPVDVQRAQQHYMQLVQQQQQQQQRYDPGRQGYLPPEFQ
QPYHALPTADGPPLMVTSTQSNYKPPARILNQPEGTDWGFLGVG
NT seq 855 nt   +upstreamnt  +downstreamnt
atggcgcctggtggtggacgagattttaactgcacctgggagcattgcaacaagtccttc
aatcgcaaatcagatctgtgcaggcactatcggatacacaccaatgagcgaccgtatcat
tgcacggtcaaggactgcaataaaagcttcattcaacggagtgcattgacagtgcattcg
cgaacgcataccggagagaagcctcatgtctgtgatcacagaggatgccacaaggccttt
tctgactcatcgagtctcgctcgtcaccgaaggatccatactggaaagaggccctatatc
tgccaagaaccaacatgcgaacgagccttctgccgcaaaacgaccttgaccaagcaccaa
caccgctctcaccccccgggatccatgactcgcctgccctccgaagatgcggtctctgaa
cactcgtatcaagggccagtcgccgttcccgtgccgaatgaacagtatctcttagcccag
caaccctactaccctcataccccgacgccgactcatgagttttacccccaccagagccta
cacataacgccggtgcccatacaagaacaaccaccgatcgtgacccagcacatccctgtc
acgtcaccggttgatgtgcagcgggctcagcaacactacatgcagcttgtgcagcaacag
caacagcaacagcagcggtacgatcctggtcggcaggggtatctgccaccggagtttcag
caaccataccatgctctacccacagcggatggtccaccgctgatggtgactagcactcag
agtaactacaaaccgccggcccgcatcctgaaccagcccgagggaacggactggggcttc
ctgggggttggctaa

DBGET integrated database retrieval system