KEGG   Aspergillus niger: ANI_1_1986184
Entry
ANI_1_1986184     CDS       T01030                                 

Gene name
An04g06590
Definition
(RefSeq) hypothetical protein
  KO
K20858  calcium uniporter protein, mitochondrial
Organism
ang  Aspergillus niger
Brite
KEGG Orthology (KO) [BR:ang00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ang03029]
    ANI_1_1986184 (An04g06590)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ang02000]
    ANI_1_1986184 (An04g06590)
Mitochondrial biogenesis [BR:ang03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Mitochondrial calcium uniporter complex
    ANI_1_1986184 (An04g06590)
Transporters [BR:ang02000]
 Other transporters
  Pores ion channels [TC:1]
   ANI_1_1986184 (An04g06590)
SSDB
Motif
Pfam: MCU
Other DBs
NCBI-GeneID: 4991066
NCBI-ProteinID: XP_001402023
AA seq 477 aa
MRSILGRVPRVGHVLPQVPRARWNTCSTAPAILGAATTRGGYNGSAHMQPNSGAVWMPLD
RRWFRAGIPGGSGMRNTRTKEQLERLRLRDRTGVVQEEQKGGDSGGKLEDAMTKGKLLTT
PSRLFKLLIPLSTGYQGEHKAILVHPQQPLSHLERLIQSEVPAIKKEDGQTRPPTVSFIA
LQIEDHPIRPRKAVYEGTGAEVHQLDEMGRIDDGEGKRIPTEDDTYTYLRRTEPSKKGEE
SEGGGRREQRFVRWSQSTEIGDFIRDAARAREFIVSVEGAPAGVHQIRVAVPSFDERTYF
LRMRLRKISGRIKGIAEIKHECDALAHRGAQRVAMGGLGILAMWWYLVYRLTFETDLGWD
TMEPVTYLVSLSTLMGGYLWFLYHNREISYRSALDFTINARQKKLYQEKGIDLQLWESLI
DEGNTLRKEIKNIAAEYDVEWDERKDERDQRVTEALKQERTQKNGNKRRGDEEEDGD
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgcggtcaattctgggtcgagttcctcgagtcgggcatgtcctcccacaagttccgcgt
gcacgatggaacacctgcagtactgctcctgctatattaggcgctgcgacgacgagagga
gggtacaatgggagtgcgcatatgcagcccaatagtggtgcggtctggatgccactagac
cggaggtggttccgtgcaggaattcctggtggtagcgggatgagaaacacccggacgaaa
gagcaattggagaggttgagattgagggatcggacgggggttgtgcaggaggagcagaag
ggaggagactcaggggggaagttggaggatgcgatgacgaagggcaagctattaacgaca
ccgtcgaggttattcaagctgttgattccgctgtcgaccggctatcagggggagcataaa
gctattctcgtccacccccaacaaccactctcccacctggaacgactaatccagtctgaa
gtcccagccattaagaaagaagacggccaaacccgccccccaaccgtctccttcatcgcc
ctccaaatcgaagaccaccccattcggccccgaaaagccgtctacgaaggcaccggcgca
gaagtccaccagctcgacgaaatgggtcgcatcgatgacggcgaaggcaagcggatcccc
acagaagacgatacatacacgtacctgcgccgcacggagcccagcaagaagggagaagaa
tcagaaggcggcggcaggagagagcagcgcttcgtacgctggtcacaatccaccgaaatt
ggagactttatccgcgacgcagcacgggcccgggaattcatcgtctccgtggaaggcgca
ccagccggggtgcatcagatccgagtagcggtgccatcgttcgacgagcggacgtacttc
ctgcgaatgagactgcggaagatctccgggcggatcaagggcatcgcggagatcaagcac
gagtgtgatgcgctagcgcaccggggagcacagcgggtggcgatgggagggctgggaatc
ctggcaatgtggtggtacctcgtgtacaggttgacgtttgagacggatctgggctgggat
acgatggagccggtgacgtatctggtgagtttgtcgacgctgatggggggatatctctgg
tttctgtaccataaccgggagatatcgtaccggtcagcgttggattttacgatcaatgcg
cggcagaagaagctgtatcaggagaaggggattgatttgcagttgtgggagtcattgatt
gacgagggaaatacgttgcgcaaggagatcaagaatattgcggcggagtatgatgtggag
tgggatgagaggaaggatgaaagggaccagagagtcacggaggcgttgaagcaggagagg
acgcagaagaatggaaataagaggagaggtgatgaggaggaggatggagattag

DBGET integrated database retrieval system